DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDY1 and HP1b

DIOPT Version :9

Sequence 1:NP_004671.1 Gene:CDY1 / 9085 HGNCID:1809 Length:554 Species:Homo sapiens
Sequence 2:NP_001162713.1 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster


Alignment Length:271 Identity:65/271 - (23%)
Similarity:106/271 - (39%) Gaps:75/271 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     5 EFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDF------NRRQTEKQK 63
            ||.||.:.||| ..||.|:|.::||||.:.::||||.::| :|...:.:|      |:::|:|: 
  Fly     3 EFSVERVEDKR-TVNGRTEYYLKWKGYPRSENTWEPVENL-DCPDLIANFEESLKNNKKETKKR- 64

Human    64 KLTWTTTSRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNRKLFAASKNVRRKAASILSD 128
                      .|.::...:.||.:.::.::..:          :.:||....:.:  :|:.||. 
  Fly    65 ----------LSTSSTPESIRSKRKSFLEDDTE----------EQKKLIGFERGL--EASKILG- 106

Human   129 TKNMEIINSTIETLAPDSPFDHKTVSGFQKLEKLDPIAADQQDT----VVFKVTEGKLLRDPLSR 189
                          |.||......:..::..:..|.:.|...:|    ||.:..|.:|.....|.
  Fly   107 --------------ATDSSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLTWHTGSG 157

Human   190 PGAEQTGIQNKTQIHPLMSQMSGSVTASMATGSATRKGIVVLIDPLAANGTTDMHTSVPRVKGGQ 254
            .|...|...|......|     |||..|.| |..|..|.|         |||          ||.
  Fly   158 NGNGNTNSVNLGSSGGL-----GSVGGSGA-GDDTAPGSV---------GTT----------GGG 197

Human   255 RNITDDSRDQP 265
            .||.....:.|
  Fly   198 SNIDGGDEEDP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDY1NP_004671.1 CHROMO 5..58 CDD:214605 23/58 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..106 2/29 (7%)
crotonase-like 286..482 CDD:119339
HP1bNP_001162713.1 CHROMO 3..52 CDD:214605 22/50 (44%)
Chromo_shadow 100..151 CDD:279701 12/65 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.