DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PYGO2 and PGA2

DIOPT Version :10

Sequence 1:NP_612157.1 Gene:PYGO2 / 90780 HGNCID:30257 Length:406 Species:Homo sapiens
Sequence 2:NP_014250.1 Gene:PGA2 / 855573 SGDID:S000005093 Length:129 Species:Saccharomyces cerevisiae


Alignment Length:38 Identity:11/38 - (28%)
Similarity:17/38 - (44%) Gaps:5/38 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    29 RKQGKAGLQ--MKSPEKKRRKSNTQGP---AYSHLTEF 61
            :||..|.::  .:..|:||.|.....|   |.:..|.|
Yeast    47 KKQLAAQVEKDKRDKEEKRSKDLIDKPDDAATAETTSF 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PYGO2NP_612157.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73 11/38 (29%)
Nuclear localization signal. /evidence=ECO:0000255 41..47 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..323
PHD_PYGO2 329..382 CDD:277106
PGA2NP_014250.1 PGA2 16..128 CDD:369416 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.