DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIRAS3 and Diras3

DIOPT Version :9

Sequence 1:NP_004666.1 Gene:DIRAS3 / 9077 HGNCID:687 Length:229 Species:Homo sapiens
Sequence 2:XP_345726.2 Gene:Diras3 / 366733 RGDID:1565168 Length:200 Species:Rattus norvegicus


Alignment Length:197 Identity:57/197 - (28%)
Similarity:98/197 - (49%) Gaps:10/197 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    24 LILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLH 88
            |:||..|      |||||::|:..|||:.|..::|.|.|.....|::|..:.:::..:.....|.
  Rat     4 LVLRPAK------DYRVVLLGSVAVGKTALATQFACGRFPERCEPSVEELFSKVIEVNRAPALLE 62

Human    89 ITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNK 153
            |.|:...:....|:...|.....||::|||..:.:.:.::...|.:.:::|:  ...|:||||.|
  Rat    63 IVDTVGAEHLVTLKDLYIRNSDGFVVLYSVCNEASFQAVRPLRERMGRLRGS--RAVPLVLVGTK 125

Human   154 SD-DTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELF-HMLLNYKKKPTTGLQEPEKKSQMP 216
            .| |..|:|....|...|.||.|.|:||:||:.:.|..:| .::...:.....|.:.|...:..|
  Rat   126 VDLDAERQVLTAQGRALAREWRCPFLEITAKSKMMVDRVFTQVVREMEALAPPGQEAPRIPANAP 190

Human   217 NT 218
            .|
  Rat   191 ET 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIRAS3NP_004666.1 P-loop_NTPase 37..200 CDD:328724 49/164 (30%)
Effector region. /evidence=ECO:0000255 66..74 2/7 (29%)
Diras3XP_345726.2 small_GTPase 10..173 CDD:197466 50/170 (29%)
P-loop_NTPase 11..172 CDD:304359 49/162 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48239
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.420

Return to query results.
Submit another query.