DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIRAS3 and Rheb

DIOPT Version :9

Sequence 1:NP_004666.1 Gene:DIRAS3 / 9077 HGNCID:687 Length:229 Species:Homo sapiens
Sequence 2:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster


Alignment Length:163 Identity:54/163 - (33%)
Similarity:85/163 - (52%) Gaps:5/163 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    36 RDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRA 100
            ::..:.::|...||||:|..::..|.|...|.||||||:.::.........:.:.|:...|....
  Fly     4 KERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSI 68

Human   101 LQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHRE--VAL 163
            .........|.:|||||:|.:::.|.:|..||.:..:.|...  .|:||||||. |.|:|  |:.
  Fly    69 FPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKY--VPVVLVGNKI-DLHQERTVST 130

Human   164 NDGATCAMEWNCAFMEISAKTDVNVQELFHMLL 196
            .:|...|..|..||:|.|||.:.:|.::||.||
  Fly   131 EEGKKLAESWRAAFLETSAKQNESVGDIFHQLL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIRAS3NP_004666.1 P-loop_NTPase 37..200 CDD:328724 54/162 (33%)
Effector region. /evidence=ECO:0000255 66..74 6/7 (86%)
RhebNP_730950.2 RheB 5..182 CDD:206709 54/162 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.