DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC11C and CG9240

DIOPT Version :10

Sequence 1:NP_150596.1 Gene:SEC11C / 90701 HGNCID:23400 Length:192 Species:Homo sapiens
Sequence 2:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster


Alignment Length:122 Identity:28/122 - (22%)
Similarity:49/122 - (40%) Gaps:35/122 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    68 SMEPAFHRGDLLFLTNFRE--------------DPIRAGEIV---VFKVEGRDIPIVHRVIKVHE 115
            ||||..|..::|......:              .||:|.:.:   :..|.| |..::.:.|.:..
  Fly    38 SMEPTLHSDNVLLTERLSKHWRTYQPGDIVIAISPIKADQFICKRIVAVSG-DQVLIQKPIPIEA 101

Human   116 KDNGDIKFLTKGDNNE----VDD---RG-LYKEGQNWLEKKDVVGRARGFLPYVGMV 164
            :.:|:      .|:.:    |.|   || ::.||.|.....|  .|..|.:| ||::
  Fly   102 EFSGN------SDDKKKPVMVKDYVPRGHVWIEGDNKGNSSD--SRYYGPIP-VGLI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC11CNP_150596.1 Peptidase_S24_S26 34..167 CDD:447902 28/122 (23%)
C-terminal short (CTS) helix. /evidence=ECO:0000269|PubMed:34388369 177..188
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 28/122 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.