DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ANGPTL1 and CG31832

DIOPT Version :9

Sequence 1:NP_001363692.1 Gene:ANGPTL1 / 9068 HGNCID:489 Length:491 Species:Homo sapiens
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:234 Identity:84/234 - (35%)
Similarity:133/234 - (56%) Gaps:34/234 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   257 TSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVI 321
            |.|:.||..|..:....|.||:..|                           |:.:  ...|.||
  Fly    24 TCPSGSPNGIHQLMLPEEEPFQVTQ---------------------------CKTT--ARDWIVI 59

Human   322 QKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSF 386
            |:|.||||||.::|.:||.|||:.:||:::||:.:|:::.:..::|.|:|:......|||.:..|
  Fly    60 QRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDF 124

Human   387 RLEPESEFYRL-RLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNL 450
            :::.|:|.|:| |:|.|.|.||||:.:|..|:|:|.|||.|..:.|||..|.||||:::|..|:|
  Fly   125 QVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSL 189

Human   451 NGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKP 489
            ||:::|.|  .:...:||.|..::  ..||..||:||:|
  Fly   190 NGLYFREG--ETGMLNGIHWGRWK--FQSLTFVQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ANGPTL1NP_001363692.1 PB1 74..138 CDD:383100
FReD 275..490 CDD:238040 78/216 (36%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 82/230 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.