DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TGIF2LY and hth

DIOPT Version :10

Sequence 1:NP_631960.1 Gene:TGIF2LY / 90655 HGNCID:18569 Length:185 Species:Homo sapiens
Sequence 2:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster


Alignment Length:52 Identity:15/52 - (28%)
Similarity:22/52 - (42%) Gaps:10/52 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   883 GKLRRRRLSFESEGEKD----FSKENSANDADDSTDTIRRYQ----SSKKHF 926
            |....|:...:.||.:.    ..|.||.|  ::|:|...|:|    ..|.||
  Fly    25 GHFNWRKTELDIEGPEGTCRILFKCNSEN--NNSSDFTIRFQLQKSDGKSHF 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TGIF2LYNP_631960.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Homeobox_KN 69..107 CDD:428673
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..185
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.