DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TGIF2LY and vis

DIOPT Version :10

Sequence 1:NP_631960.1 Gene:TGIF2LY / 90655 HGNCID:18569 Length:185 Species:Homo sapiens
Sequence 2:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster


Alignment Length:141 Identity:55/141 - (39%)
Similarity:81/141 - (57%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    29 DTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLS 93
            |..:.|.::.|....|      :||:||||..|||||:.|:|:||:.||||:.||..||::.||:
  Fly    76 DMMVDSEHHVDINGSL------RKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLT 134

Human    94 LLRISNWFINARRRILPDMLQQRRNDPI---IGHKTGKDAHATH---------------LQSTEA 140
            :|::.||||||||||||:|:::..|||:   |..:..|...||.               |.:.|.
  Fly   135 VLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVVGATEEVDGAGEIHEGIANVLTNFEQ 199

Human   141 SVPAKSGPVVQ 151
            .|...:|.:|:
  Fly   200 YVQGPNGQMVK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TGIF2LYNP_631960.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 8/28 (29%)
Homeobox_KN 69..107 CDD:428673 21/37 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..185
visNP_788337.1 Homeobox_KN 110..148 CDD:428673 21/37 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.