DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LYRM7 and CG34150

DIOPT Version :10

Sequence 1:NP_859056.2 Gene:LYRM7 / 90624 HGNCID:28072 Length:104 Species:Homo sapiens
Sequence 2:NP_001036756.2 Gene:CG34150 / 4379863 FlyBaseID:FBgn0083986 Length:137 Species:Drosophila melanogaster


Alignment Length:97 Identity:44/97 - (45%)
Similarity:63/97 - (64%) Gaps:13/97 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     6 KVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSV 70
            :||..||.||||||.||:.||.||.|.|:||||.|..|::|:|..:|::::|:..||:|.|||:|
  Fly     7 QVLSAFKKLHRTRQYVFQGDANALAAGRLKINESFLQNRNESSEDEIQKMIKLAQDVDLELRTNV 71

Human    71 IQ------GIHTDHNTLKLVP---RKDLLVEN 93
            ||      |::    .|::.|   |.|.:|.|
  Fly    72 IQAQKKEDGVY----ELRITPETTRLDNVVFN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LYRM7NP_859056.2 Complex1_LYR_LYRM7 7..77 CDD:380762 38/75 (51%)
CG34150NP_001036756.2 Complex1_LYR_LYRM7 8..79 CDD:380762 37/70 (53%)

Return to query results.
Submit another query.