DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH2D2A and Pi3K21B

DIOPT Version :9

Sequence 1:XP_016858251.1 Gene:SH2D2A / 9047 HGNCID:10821 Length:405 Species:Homo sapiens
Sequence 2:NP_001259817.1 Gene:Pi3K21B / 33203 FlyBaseID:FBgn0020622 Length:496 Species:Drosophila melanogaster


Alignment Length:214 Identity:44/214 - (20%)
Similarity:71/214 - (33%) Gaps:72/214 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    74 LFLQAETRAWFQ----------KTQAHWLLQHGAAPAWFHGFITRRVRPPLSVTHREAERLLEPK 128
            :.||.....|.|          ..:|.|||:                    ....|.||.:|:..
  Fly   300 MILQMGFDKWQQLYETVSNQPHSNEALWLLK--------------------DAKRRNAEEMLKGA 344

Human   129 PQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSP 193
            |.|.:|:| :..|..:.|:...:...:|.|:.:...| .......:.:|.|:.|:.||..:.|..
  Fly   345 PSGTFLIR-ARDAGHYALSIACKNIVQHCLIYETSTG-FGFAAPYNIYATLKSLVEHYANNSLEE 407

Human   194 YGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAP-----VPMQKEGAGEK 253
            :.:|||..|.                             .|::.....|     :.:|:|...|.
  Fly   408 HNDTLTTTLR-----------------------------WPVLYWKNNPLQVQMIQLQEEMDLEY 443

Human   254 EPSQLLRPKP------PIP 266
            |.:..|||.|      |||
  Fly   444 EQAATLRPPPMMGSSAPIP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH2D2AXP_016858251.1 None
Pi3K21BNP_001259817.1 SH2_nSH2_p85_like 14..123 CDD:198195
PI3K_P85_iSH2 129..302 CDD:293063 0/1 (0%)
iSH2_PI3K_IA_R 138..303 CDD:304922 0/2 (0%)
SH2_cSH2_p85_like 320..422 CDD:198184 28/152 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.