Sequence 1: | XP_016858251.1 | Gene: | SH2D2A / 9047 | HGNCID: | 10821 | Length: | 405 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259817.1 | Gene: | Pi3K21B / 33203 | FlyBaseID: | FBgn0020622 | Length: | 496 | Species: | Drosophila melanogaster |
Alignment Length: | 214 | Identity: | 44/214 - (20%) |
---|---|---|---|
Similarity: | 71/214 - (33%) | Gaps: | 72/214 - (33%) |
- Green bases have known domain annotations that are detailed below.
Human 74 LFLQAETRAWFQ----------KTQAHWLLQHGAAPAWFHGFITRRVRPPLSVTHREAERLLEPK 128
Human 129 PQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSP 193
Human 194 YGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAP-----VPMQKEGAGEK 253
Human 254 EPSQLLRPKP------PIP 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SH2D2A | XP_016858251.1 | None | |||
Pi3K21B | NP_001259817.1 | SH2_nSH2_p85_like | 14..123 | CDD:198195 | |
PI3K_P85_iSH2 | 129..302 | CDD:293063 | 0/1 (0%) | ||
iSH2_PI3K_IA_R | 138..303 | CDD:304922 | 0/2 (0%) | ||
SH2_cSH2_p85_like | 320..422 | CDD:198184 | 28/152 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |