DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCFD2 and CG17271

DIOPT Version :10

Sequence 1:NP_644808.1 Gene:MCFD2 / 90411 HGNCID:18451 Length:146 Species:Homo sapiens
Sequence 2:NP_650916.1 Gene:CG17271 / 42463 FlyBaseID:FBgn0038829 Length:281 Species:Drosophila melanogaster


Alignment Length:122 Identity:52/122 - (42%)
Similarity:74/122 - (60%) Gaps:13/122 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    35 QPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITH 99
            ||..:....|...::.||.||::..|:  .::||..|||.|||||||.|.||.|||.||..::.|
  Fly   134 QPQQVLNTGNIQQERAHIQEHMQVPID--TSKMSEAELQFHYFKMHDSDNNNKLDGCELIKSLIH 196

Human   100 VHKEEGSEQAP----------LMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ 146
            .| |:||::.|          :.|::||:.:||.:|:.||.:.||||||.||.|:.|
  Fly   197 WH-EQGSKEQPNGEKPHVEEKVFSDEELVALIDPILQMDDTSRDGYIDYPEFIKAQQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCFD2NP_644808.1 EF-hand_7 77..143 CDD:463900 35/75 (47%)
CG17271NP_650916.1 EF-hand_7 174..250 CDD:463900 35/76 (46%)

Return to query results.
Submit another query.