DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2M and ben

DIOPT Version :10

Sequence 1:NP_003960.1 Gene:UBE2M / 9040 HGNCID:12491 Length:183 Species:Homo sapiens
Sequence 2:NP_511150.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster


Alignment Length:127 Identity:40/127 - (31%)
Similarity:70/127 - (55%) Gaps:8/127 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    31 QLRIQKDINELNLPKTCDISFSDPDDLLNFKLVIC-PDEGFYKSGKFVFSFKVGQGYPHDPPKVK 94
            |..:|:.:..:|       :..|.::...|.:::. |::..::.|.|.....:.:.||...|||:
  Fly    13 QRLMQEPVPGIN-------AIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKVR 70

Human    95 CETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNN 156
            ..|.:||||||..|.:||::|::.|.|.|.|.:|:..:|.|...|||:|||..:.||:.:.|
  Fly    71 FITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKVN 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2MNP_003960.1 Interaction with UBA3 1..57 4/25 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
UBCc_UBE2F_UBE2M 29..166 CDD:467414 40/127 (31%)
benNP_511150.1 UBCc_UBE2N 4..147 CDD:467433 40/127 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.