DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SAMD1 and tir-1

DIOPT Version :9

Sequence 1:	NP_612361.1	Gene:	SAMD1 / 90378	HGNCID:	17958	Length:	538	Species:	Homo sapiens
Sequence 2:	NP_001299866.1	Gene:	tir-1 / 175502	WormBaseID:	WBGene00006575	Length:	984	Species:	Caenorhabditis elegans

Alignment Length:	80	Identity:	20/80 - (25%)
Similarity:	35/80 - (43%)	Gaps:	4/80 - (5%)

- Green bases have known domain annotations that are detailed below.

Human   462 WTVMDVVEYFTEAGFPEQATAFQEQEIDGKSLLLMQRTDVLTGLSIRLGPALKIYEHHIKVLQ-- 524
            ||..||..:..:.||.|....|.:|.:||..||.:...|:...:.:..|...|.:...::.|:
Worm   614 WTCADVQYWVKKIGFEEYVEKFAKQMVDGDLLLQLTENDLKHDVGMISGLHRKRFLRELQTLKVA 678

Human   525 --QGHFEDDDPDGFL 537
              ....::.:.|.||
Worm   679 ADYSSVDESNLDNFL 693

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SAMD1	NP_612361.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..30
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	92..247
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	282..458
		SAM_Atherin-like	459..527	CDD:188982	17/68 (25%)
		SAM	459..525	CDD:197735	17/66 (26%)
tir-1	NP_001299866.1	SAM_SARM1-like_repeat1	611..679	CDD:188900	17/64 (27%)
		SAM	611..676	CDD:197735	16/61 (26%)
		SAM_SARM1-like_repeat2	680..749	CDD:188901	3/14 (21%)
		SAM	681..750	CDD:197735	3/13 (23%)
		TIR	761..904	CDD:214587
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910