DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SAMD1 and mys-2

DIOPT Version :9

Sequence 1:	NP_612361.1	Gene:	SAMD1 / 90378	HGNCID:	17958	Length:	538	Species:	Homo sapiens
Sequence 2:	NP_001309531.1	Gene:	mys-2 / 173281	WormBaseID:	WBGene00010537	Length:	533	Species:	Caenorhabditis elegans

Alignment Length:	81	Identity:	24/81 - (29%)
Similarity:	29/81 - (35%)	Gaps:	17/81 - (20%)

- Green bases have known domain annotations that are detailed below.

Human    66 PERTRAELEKLIQQRAVLRVSYKGSISYRNAARVQPPRRGATPPAPPRAPRGAPAAAAAAAPPPT 130
            |.:||.|.|:..|:.|....|.:.|.|......|.|.   ||||...:             |..|
Worm   461 PAQTRPEFERQQQRTAAAMTSRRASKSQNVTPLVTPL---ATPPIEQK-------------PEDT 509

Human   131 PAPPP-PPAPVAAAAP 145
            ..|.| ....||..||
Worm   510 YTPSPLTDHHVATDAP 525

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SAMD1	NP_612361.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..30
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	92..247		15/55 (27%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	282..458
		SAM_Atherin-like	459..527	CDD:188982
		SAM	459..525	CDD:197735
mys-2	NP_001309531.1	Tudor-knot	53..110	CDD:288553
		NAT_SF	170..418	CDD:302625
		MOZ_SAS	244..418	CDD:280097
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5027
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900