powered by:
Protein Alignment SAMD1 and samd13
DIOPT Version :9
Sequence 1: | NP_612361.1 |
Gene: | SAMD1 / 90378 |
HGNCID: | 17958 |
Length: | 538 |
Species: | Homo sapiens |
Sequence 2: | XP_012816011.2 |
Gene: | samd13 / 100135078 |
XenbaseID: | XB-GENE-5864959 |
Length: | 116 |
Species: | Xenopus tropicalis |
Alignment Length: | 75 |
Identity: | 52/75 - (69%) |
Similarity: | 60/75 - (80%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 455 KPSDPVEWTVMDVVEYFTEAGFPEQATAFQEQEIDGKSLLLMQRTDVLTGLSIRLGPALKIYEHH 519
:|.||..|.|.|||.||..|||.|||:||:||||||||||||.|.|||||||::|||||||||:|
Frog 38 RPPDPAHWAVDDVVNYFKTAGFEEQASAFKEQEIDGKSLLLMTRNDVLTGLSLKLGPALKIYEYH 102
Human 520 IKVLQQGHFE 529
:|.||..|.:
Frog 103 VKPLQTQHLK 112
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
NCBI |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D278758at33208 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004693 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.