DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAMD1 and samd13

DIOPT Version :9

Sequence 1:NP_612361.1 Gene:SAMD1 / 90378 HGNCID:17958 Length:538 Species:Homo sapiens
Sequence 2:XP_012816011.2 Gene:samd13 / 100135078 XenbaseID:XB-GENE-5864959 Length:116 Species:Xenopus tropicalis


Alignment Length:75 Identity:52/75 - (69%)
Similarity:60/75 - (80%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   455 KPSDPVEWTVMDVVEYFTEAGFPEQATAFQEQEIDGKSLLLMQRTDVLTGLSIRLGPALKIYEHH 519
            :|.||..|.|.|||.||..|||.|||:||:||||||||||||.|.|||||||::|||||||||:|
 Frog    38 RPPDPAHWAVDDVVNYFKTAGFEEQASAFKEQEIDGKSLLLMTRNDVLTGLSLKLGPALKIYEYH 102

Human   520 IKVLQQGHFE 529
            :|.||..|.:
 Frog   103 VKPLQTQHLK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAMD1NP_612361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..247
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..458 1/2 (50%)
SAM_Atherin-like 459..527 CDD:188982 49/67 (73%)
SAM 459..525 CDD:197735 48/65 (74%)
samd13XP_012816011.2 SAM_Atherin-like 42..110 CDD:188982 49/67 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D278758at33208
OrthoFinder 1 1.000 - - FOG0004693
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.