DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAMD1 and samd13

DIOPT Version :10

Sequence 1:NP_612361.1 Gene:SAMD1 / 90378 HGNCID:17958 Length:538 Species:Homo sapiens
Sequence 2:XP_012816011.2 Gene:samd13 / 100135078 XenbaseID:XB-GENE-5864959 Length:116 Species:Xenopus tropicalis


Alignment Length:75 Identity:52/75 - (69%)
Similarity:60/75 - (80%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   455 KPSDPVEWTVMDVVEYFTEAGFPEQATAFQEQEIDGKSLLLMQRTDVLTGLSIRLGPALKIYEHH 519
            :|.||..|.|.|||.||..|||.|||:||:||||||||||||.|.|||||||::|||||||||:|
 Frog    38 RPPDPAHWAVDDVVNYFKTAGFEEQASAFKEQEIDGKSLLLMTRNDVLTGLSLKLGPALKIYEYH 102

Human   520 IKVLQQGHFE 529
            :|.||..|.:
 Frog   103 VKPLQTQHLK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAMD1NP_612361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..247
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..458 1/2 (50%)
SAM_Atherin-like 459..527 CDD:188982 49/67 (73%)
samd13XP_012816011.2 SAM_Atherin-like 42..110 CDD:188982 49/67 (73%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.