DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEMA5A and Sema1b

DIOPT Version :9

Sequence 1:NP_003957.2 Gene:SEMA5A / 9037 HGNCID:10736 Length:1074 Species:Homo sapiens
Sequence 2:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster


Alignment Length:529 Identity:186/529 - (35%)
Similarity:271/529 - (51%) Gaps:65/529 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    54 NAVDFSQLTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYI 118
            |:.|:.:: .|...:.::|||::.::.:.|..|..|..:||...:|.::.|..|||.:.:|.||:
  Fly    56 NSTDYFKI-LDHNDEFVLVGAKDVIYNVSLNGLKEIARLEWHSTDADRELCALKGKHEWDCHNYL 119

Human   119 RV--LLVGGDRLFTCGTNAFTPVCTNRSLSNLT---------------EIHDQISGMARCPYSPQ 166
            ||  |...|:.|. ||||::.|.|.:.:...::               |:...:.....|||||.
  Fly   120 RVYALRPNGEVLL-CGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGLCPYSPA 183

Human   167 HNSTALLTAGGELYAATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYF 231
            ||||... |.|.||:||..||.|.||.|||.     .|||.||:.|.||:|:||.:.:...:..|
  Fly   184 HNSTYAF-ADGHLYSATVADFSGGDPLIYRE-----NLRTEQYDLKQLNQPDFVGAIERNGYVLF 242

Human   232 FFRENAVE-HDCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTF 295
            ||||.::| .:.||.|:||.|||||||.||.:....:||:|:|||||||.|||.|||::|:|:..
  Fly   243 FFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPGEFPFYFDEIQAIS 307

Human   296 FLPE---LDLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLP-----YPNPN 352
            .:.|   ..|||.:|||:||:|..||||.||:..|..||.|.||.|::|:|.|||     .|.|.
  Fly   308 PIVESGSKSLIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWLPVEREQVPKPR 372

Human   353 PHFQCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDN--SRFSHVAV--DVVQGR 413
            |. ||  |:...  .||...:...:...||.|.|..|...|...:.|  .|.:.:||  .|....
  Fly   373 PG-QC--VEDSR--TLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRLTAIAVHPQVKSLS 432

Human   414 EALVHIIYLATDYGTIKK-VRVPLNQTSS------SCLLEEIELFPERRREPIRSLQILHSQSVL 471
            .|...:||..||.|.:.| :.:.....:|      :.::.|:::.|  ...|||.|.|..|::.|
  Fly   433 GAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLP--LGTPIRELVISTSKNSL 495

Human   472 FVGLREHVVKIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLE------------ESLSMTQ 524
            .|.....:|.:||..|........|:..|||.|.||:...:|.:|.            :||:.|:
  Fly   496 VVVSDGSLVSVPLHHCSHIVDCLGCLSLQDPICAWDLQTHEC
KNLATSQHKFGTKTYLQSLNSTK 560

Human   525 WEQSISACP 533
             :.:...||
  Fly   561 -KAAALLCP 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEMA5ANP_003957.2 Sema_5A 50..485 CDD:200524 170/467 (36%)
PSI 486..533 CDD:279745 13/58 (22%)
TSP1 544..595 CDD:214559
TSP1 598..651 CDD:214559
TSP1 656..702 CDD:214559
TSP1 787..839 CDD:214559
TSP1 844..896 CDD:214559
TSP1 899..940 CDD:214559
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 171/469 (36%)
PSI 510..>537 CDD:214655 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.