DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RHBDL1 and SPBC13E7.11

DIOPT Version :9

Sequence 1:XP_024306253.1 Gene:RHBDL1 / 9028 HGNCID:10007 Length:526 Species:Homo sapiens
Sequence 2:NP_596266.2 Gene:SPBC13E7.11 / 2540108 PomBaseID:SPBC13E7.11 Length:298 Species:Schizosaccharomyces pombe


Alignment Length:166 Identity:39/166 - (23%)
Similarity:61/166 - (36%) Gaps:37/166 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   182 VDRRWYFYRHRSCPPPV-------FMASVTLAQIIVFLCYGA----RLNKWVLQTY---HPEYMK 232
            :|:|...|...|...|:       .:.|:....:.||..:.|    .||:: ||.|   :|.::.
pombe    55 LDKRRKNYPKSSYGFPIPQTSSRSLVLSIIGINVGVFALWRAPRFSHLNRF-LQKYAVMNPIFIN 118

Human   233 SP--LVYHPGHRARAWRFL-----TYMFMHVGLEQLGFNALLQLMIGVPL-----EMVHGLLRIS 285
            .|  :|....|:: .|..|     .|.|....::..|.|..:...|...|     .::|..||..
pombe   119 MPSMIVSAFSHQS-GWHLLFNMVAFYSFAPAIVDVFGNNQFVAFYISSILFSNVASLLHHRLRFG 182

Human   286 LLYLAGVLAGEAGAHPRPLPWPAAPSPAACSHRLPN 321
            .....|.| |.:||        .....||.|:..||
pombe   183 TKVTPGSL-GASGA--------IYAIAAATSYFFPN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RHBDL1XP_024306253.1 Rhomboid 239..>295 CDD:328780 14/65 (22%)
SPBC13E7.11NP_596266.2 Rhomboid 122..269 CDD:279958 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.