DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RHBDL1 and rom-1

DIOPT Version :9

Sequence 1:XP_024306253.1 Gene:RHBDL1 / 9028 HGNCID:10007 Length:526 Species:Homo sapiens
Sequence 2:NP_498029.2 Gene:rom-1 / 184989 WormBaseID:WBGene00004400 Length:356 Species:Caenorhabditis elegans


Alignment Length:260 Identity:65/260 - (25%)
Similarity:107/260 - (41%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    88 IGADTFTGLVHSHELPLDPAKLDMLVALAQSNEQGQVCYQELVDLISSKRSSSFKRAIANGQRAL 152
            |...|....:.:.::||...::.   |:.::.:       ||||:...::..:.|.|    ||: 
 Worm    27 IPMSTLASRIETRKIPLTNGQIH---AIKEAPD-------ELVDIDGFQKIVTSKAA----QRS- 76

Human   153 PRDGPLDEPGLGVYKRFVRYVAYEIL--PCEVDRRWYFYRHRSCPPPVFMASVTLAQIIVFLCY- 214
                        ..||.:..:|..|:  ..:::...|...:..||||:||..:|:.|:.:|..| 
 Worm    77 ------------TIKRIMYDMADPIMSDSQKIEVHSYIDSYSWCPPPIFMLLITIIQVGIFFFYW 129

Human   215 ---GARLNKWV----LQTYHPEYMKSPLVYHPGHRARAWRFLTYMFMHVGLEQLGFNALLQLMIG 272
               |.| :.|.    ...:|........::.|..|..||||.:|||:|.||..|..|.::||::|
 Worm   130 ESDGGR-SIWTDCAGCFVHHNHTAPGIFIFAPKLRGEAWRFTSYMFLHAGLNHLLGNVIIQLLVG 193

Human   273 VPLEMVHGLLRISLLYLAGVLAG----------------EAGA---------------HPRPLPW 306
            :|||:.|.:.||..:||..|.:|                .||.               |..||.|
 Worm   194 IPLEVAHKIWRIGPIYLLAVTSGSLLQYAIDPNSLLVGASAGVYALIFAHVANVILNWHEMPLRW 258

Human   307  306
             Worm   259  258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RHBDL1XP_024306253.1 Rhomboid 239..>295 CDD:328780 26/55 (47%)
rom-1NP_498029.2 Rhomboid 160..308 CDD:279958 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I3202
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - otm15732
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2770
SonicParanoid 1 1.000 - - X2844
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.960

Return to query results.
Submit another query.