DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RNF8 and nopo

DIOPT Version :9

Sequence 1:	NP_003949.1	Gene:	RNF8 / 9025	HGNCID:	10071	Length:	485	Species:	Homo sapiens
Sequence 2:	NP_611305.1	Gene:	nopo / 37083	FlyBaseID:	FBgn0034314	Length:	435	Species:	Drosophila melanogaster

Alignment Length:	68	Identity:	23/68 - (33%)
Similarity:	35/68 - (51%)	Gaps:	5/68 - (7%)

- Green bases have known domain annotations that are detailed below.

Human   401 LQCIICSEYFIEA----VTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMV 461
            |.|:||:|.|.:|    .|: |.|.|...|:|:|:.|...||.||....::....|..|..|..|
  Fly     4 LNCVICAELFGQADEVFATV-CGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYFNLANLDV 67

Human   462 NNL 464
            :::
  Fly    68 SHI 70

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RNF8	NP_003949.1	FHA	17..110	CDD:238017
		Required for interaction with PIWIL1. /evidence=ECO:0000255\|HAMAP-Rule:MF_03067	68..72
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	181..220
		Golgin_A5	264..>379	CDD:313078
		PHA02929	<370..485	CDD:331986	23/68 (34%)
		RING-HC_RNF8	400..441	CDD:319449	17/43 (40%)
		RING-HC finger (C3HC4-type)	403..440	CDD:319449	16/40 (40%)
nopo	NP_611305.1	zf-RING_2	5..47	CDD:290367	16/42 (38%)
nopo	NP_611305.1	zf-rbx1	<5..47	CDD:289448	16/42 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910