DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A14 and Ucp4A

DIOPT Version :9

Sequence 1:NP_001269126.1 Gene:SLC25A14 / 9016 HGNCID:10984 Length:353 Species:Homo sapiens
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:332 Identity:108/332 - (32%)
Similarity:178/332 - (53%) Gaps:62/332 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    41 FVYGGLASIVAEFGTFPVDLTKTRLQVQGQSI--DARFKEIKYRGMFHALFRICKEEGVLALYSG 103
            ::...:|:.:||..|:|:||||||||:||:..  .|....::||||....|.|.:|||.|.|:.|
  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQG 108

Human   104 IAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRM 166
            :.|||.|...|..::|..|..:::.|.:. ..:.|.:  :.:|||.:|.::..:|:|.|::|:::
  Fly   109 VTPALYRHVVYSGVRICSYDLMRKEFTQN-GTQALPVWKSALCGVTAGAVAQWLASPADLVKVQI 172

Human   167 QAQGSLFQGSMIG----------SFIDIYQQEGTRGLWRCLCSKAVTGCVLWLMPVIPALWEANA 221
            |.:|   :..::|          :|..|.|:.|.:|||:                          
  Fly   173 QMEG---RRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWK-------------------------- 208

Human   222 GGSLEGVVPTAQRAAIVVGVELPVYDITKKHLILSGM-MGDTILTHFVSSFTCGLAGALASNPVD 285
                 |.:|..||||:|...:|..|| |.||||::.: |.|....|.::|...|...|:...|.|
  Fly   209 -----GSIPNVQRAALVNLGDLTTYD-TIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPAD 267

Human   286 VVRTRMMNQ------RAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFIT 344
            ||:||:|||      |.:     ||:|:||.:.:....|||.||||||.|.|:|:.||::.|:::
  Fly   268 VVKTRIMNQPTDENGRGL-----LYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLS 327

Human   345 YEQLKRL 351
            :||::::
  Fly   328 FEQIRKM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A14NP_001269126.1 Mito_carr 37..133 CDD:278578 36/93 (39%)
PTZ00169 41..351 CDD:240302 108/330 (33%)
Mito_carr 134..254 CDD:278578 32/131 (24%)
Mito_carr 262..351 CDD:278578 36/94 (38%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 108/332 (33%)
Mito_carr 39..138 CDD:278578 36/94 (38%)
Mito_carr 142..239 CDD:278578 34/131 (26%)
Mito_carr 248..336 CDD:278578 36/92 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.