DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCNG2 and CycB3

DIOPT Version :9

Sequence 1:NP_004345.1 Gene:CCNG2 / 901 HGNCID:1593 Length:344 Species:Homo sapiens
Sequence 2:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster


Alignment Length:154 Identity:34/154 - (22%)
Similarity:58/154 - (37%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    12 HEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKVEDLRSLANFFGSCTET 76
            |..:.:...|.|          ||....:.:..|...: |...:|...|:.:..:...|....||
  Fly   304 HYAMDIFNYLKV----------REAEFPIADYMPRQIH-LTTWMRTLLVDWMVEVQETFELNHET 357

Human    77 FVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKRM 141
            ..|||.|:|.:|....:..:.|..:|..:|.:|.:..|.  ..|...|.:.|........::.||
  Fly   358 LYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDER--QPPLIEDFLYICDGAYNHDELVRM 420

Human   142 EKIISEKLHYELEATTALNFLHLY 165
            |:.....:.|:|....:..||..|
  Fly   421 ERETLRVIKYDLGIPLSYRFLRRY 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCNG2NP_004345.1 CYCLIN_CCNG2 55..150 CDD:410287 22/94 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..320
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 29/137 (21%)
Cyclin_C 435..555 CDD:281044 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.