DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCNG2 and CycB3

DIOPT Version :10

Sequence 1:NP_004345.1 Gene:CCNG2 / 901 HGNCID:1593 Length:344 Species:Homo sapiens
Sequence 2:NP_651303.2 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster


Alignment Length:154 Identity:34/154 - (22%)
Similarity:58/154 - (37%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    12 HEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKVEDLRSLANFFGSCTET 76
            |..:.:...|.|          ||....:.:..|...: |...:|...|:.:..:...|....||
  Fly   304 HYAMDIFNYLKV----------REAEFPIADYMPRQIH-LTTWMRTLLVDWMVEVQETFELNHET 357

Human    77 FVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKRM 141
            ..|||.|:|.:|....:..:.|..:|..:|.:|.:..|.  ..|...|.:.|........::.||
  Fly   358 LYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDER--QPPLIEDFLYICDGAYNHDELVRM 420

Human   142 EKIISEKLHYELEATTALNFLHLY 165
            |:.....:.|:|....:..||..|
  Fly   421 ERETLRVIKYDLGIPLSYRFLRRY 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCNG2NP_004345.1 CYCLIN_CCNG2 55..150 CDD:410287 22/94 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..320
CycB3NP_651303.2 CYCLIN_CCNB3_rpt1 290..431 CDD:410212 29/139 (21%)
CYCLIN_CCNB3_rpt2 435..555 CDD:410214 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.