DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACVR1 and tkv

DIOPT Version :9

Sequence 1:NP_001096.1 Gene:ACVR1 / 90 HGNCID:171 Length:509 Species:Homo sapiens
Sequence 2:NP_787990.1 Gene:tkv / 33753 FlyBaseID:FBgn0003716 Length:575 Species:Drosophila melanogaster


Alignment Length:520 Identity:238/520 - (45%)
Similarity:326/520 - (62%) Gaps:53/520 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    22 EDEKPKV--NPKLYMCVCEGLSCG---NEDHCE---GQQCFSSLS--INDGFHVYQK----GCFQ 72
            ::||.|.  |.:...|.|:| ||.   :...||   |..|||::.  .::...:|::    ||..
  Fly    68 DNEKSKTVENARSLTCYCDG-SCPDNVSNGTCETRPGGSCFSAVQQLYDETTGMYEEERTYGCMP 131

Human    73 VYEQGK-MTCKTPPSP---GQAVECC-QGDWCNRNI----TAQLPTKGKSFP-GTQNFH-LEV-G 125
            ..:.|. :.||....|   |:.:.|| :.|:|||::    |.:|.|.....| .:::.| |.| |
  Fly   132 PEDNGGFLMCKVAAVPHLHGKNIVCCDKEDFCNRDLYPTYTPKLTTPAPDLPVSSESLHTLAVFG 196

Human   126 LIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTS 190
            .||:|:...:.::|.|.....|:.|.|.|.||         |..:..:.:  |.|:.|::.|  |
  Fly   197 SIIISLSVFMLIVASLCFTYKRREKLRKQPRL---------INSMCNSQL--SPLSQLVEQS--S 248

Human   191 GSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTV 255
            |||||||.|||||:|:||.::..||||||||||...|:.|.||||.|.:.:|.|||||||:|.||
  Fly   249 GSGSGLPLLVQRTIAKQIQMVRLVGKGRYGEVWLAKWRDERVAVKTFFTTEEASWFRETEIYQTV 313

Human   256 MLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLH 320
            ::||:|||||||:|:....|.||:.|||.|||||||:|||.::.::......:..|:||||||||
  Fly   314 LMRHDNILGFIAADIKGNGSWTQMLLITDYHEMGSLHDYLSMSVINPQKLQLLAFSLASGLAHLH 378

Human   321 IEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPE 385
            .|||||.|||||||||:||||||||:||||.|||.||||.::...:.:.:..||||||:||||||
  Fly   379 DEIFGTPGKPAIAHRDIKSKNILVKRNGQCAIADFGLAVKYNSELDVIHIAQNPRVGTRRYMAPE 443

Human   386 VLDETIQVDCFDSYKRVDIWAFGLVLWEVARRM------VSNGIVEDYKPPFYDVVPNDPSFEDM 444
            ||.:.:....|:.:||.|:::.||||||:.||.      ......|||..|::||||:||:||||
  Fly   444 VLSQQLDPKQFEEFKRADMYSVGLVLWEMTRRCYTPVSGTKTTTCEDYALPYHDVVPSDPTFEDM 508

Human   445 RKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC 509
            ..||||...||.||:||..|..|.:::|:|:|||:.||:.||||||:|||       |.:|:|||
  Fly   509 HAVVCVKGFRPPIPSRWQEDDVLATVSKIMQECWHPNPTVRLTALRVKKT-------LGRLETDC 566

Human   510  509
              Fly   567  566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACVR1NP_001096.1 Activin_recp 37..103 CDD:395845 24/82 (29%)
TGF_beta_GS 179..206 CDD:400699 16/26 (62%)
STKc_ACVR1_ALK1 202..499 CDD:271044 169/302 (56%)
tkvNP_787990.1 Activin_recp 81..171 CDD:279413 25/90 (28%)
GS 238..266 CDD:197743 18/29 (62%)
S_TKc 267..557 CDD:214567 161/289 (56%)
STKc_BMPR1 270..562 CDD:271046 165/298 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144594
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D338017at33208
OrthoFinder 1 1.000 - - FOG0000203
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X151
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.