DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAPLN and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:369 Identity:74/369 - (20%)
Similarity:121/369 - (32%) Gaps:141/369 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   924 GQLVRLSCSDDTAPESQAAWQKDGQPI--------------------SSDRHRLQFDGSLIIHPL 968
            |:.|:|:||.......:.||....|..                    ..|:||..|   |.|:.:
  Fly    66 GRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWF---LHINNV 127

Human   969 QAEDAGTYSCGSTRPGRDSQKIQLRIIGGDMAVLSEAELSRFPQPRDPAQDFGQAGAAGPLGAIP 1033
            |.||.|.|.|........:|...::::                                    :|
  Fly   128 QEEDRGRYMCQINTVTAKTQYGFVKVV------------------------------------VP 156

Human  1034 SSHPQPANRLRLDQNQPRVVDA--------SPGQRIRMTCRAEGFPPPAIEWQR-DGQPVSSPR- 1088
                            |.:.||        ..|..:.:.|:|:|.|.|.|:|:| ||..:...: 
  Fly   157 ----------------PNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKT 205

Human  1089 ---HQLQPDGSLVISRVAVEDGGFYTCVAFNGQDRDQRWVQLRVLGELTISGLPPTVT------- 1143
               |.|:.| ||.:.|::....|.|.|:|.|                    |:||:|:       
  Fly   206 LEVHDLETD-SLELERISRLHMGAYLCIASN--------------------GVPPSVSKRIKVSV 249

Human  1144 --------------VPEGDTARLLCVVAGESVNIR-WSRNGLPVQADGHRV-------HQSPDGT 1186
                          :|.|....|.|.:.....::. |:|....:..:..:.       |.|...|
  Fly   250 DFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKAT 314

Human  1187 --LLIYNLRARDEGSYTCSAYQGSQAVSRSTEVKVVSPAPTAQP 1228
              |.|.|:::.|.|:|.|.|......:..:.::.:.|| ||.||
  Fly   315 MRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSP-PTTQP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767
Ig 914..>978 CDD:325142 19/73 (26%)
I-set 1049..1119 CDD:254352 25/82 (30%)
IG 1139..1219 CDD:214652 20/110 (18%)
PLAC 1235..1267 CDD:312271
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 21/127 (17%)
Ig 69..139 CDD:143165 19/72 (26%)
IG_like 165..249 CDD:214653 26/104 (25%)
IGc2 172..237 CDD:197706 22/85 (26%)
IG_like 267..348 CDD:214653 16/80 (20%)
Ig 270..339 CDD:299845 15/68 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.