DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGLYRP1 and PGRP-SB1

DIOPT Version :9

Sequence 1:NP_005082.1 Gene:PGLYRP1 / 8993 HGNCID:8904 Length:196 Species:Homo sapiens
Sequence 2:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster


Alignment Length:174 Identity:63/174 - (36%)
Similarity:100/174 - (57%) Gaps:9/174 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    29 CC-------SPIVPRNEWKALASECAQHLSLPLRYVVVSHTAG-SSCNTPASCQQQARNVQHYHM 85
            ||       ..|.||:.|.|:::.....:|..:.||::.|:.. :.|:|...|::..:|:|..|.
  Fly    16 CCLALSANALQIEPRSSWGAVSARSPSRISGAVDYVIIHHSDNPNGCSTSEQCKRMIKNIQSDHK 80

Human    86 KTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQG 150
            ....:.|:||||::..||.||||||:...|:||.: :|..||||.|:||:....|:.|.::.|:.
  Fly    81 GRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHSPN-YNRKSIGIVFIGNFERSAPSAQMLQNAKD 144

Human   151 LLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYR 194
            |:.....:|.|:.||.|.|||..:.|..||:.||:.|:.|||:|
  Fly   145 LIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGLYRP1NP_005082.1 PGRP 31..173 CDD:128941 51/142 (36%)
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 51/142 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.