Sequence 1: | NP_005082.1 | Gene: | PGLYRP1 / 8993 | HGNCID: | 8904 | Length: | 196 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648299.3 | Gene: | PGRP-LF / 39064 | FlyBaseID: | FBgn0035977 | Length: | 369 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 70/201 - (34%) |
---|---|---|---|
Similarity: | 109/201 - (54%) | Gaps: | 13/201 - (6%) |
- Green bases have known domain annotations that are detailed below.
Human 4 RSMLLAWALPSLLRLGAAQ---------ETEDPACCSPIVPRNEWKA-LASECAQHLSLPLRYVV 58
Human 59 VSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAH-SGHLW 122
Human 123 NPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLI 187
Human 188 QNWPHY 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PGLYRP1 | NP_005082.1 | PGRP | 31..173 | CDD:128941 | 52/143 (36%) |
PGRP-LF | NP_648299.3 | PGRP | 57..199 | CDD:128941 | 52/143 (36%) |
PGRP | 236..363 | CDD:295442 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152323 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5479 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S6354 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1110472at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000842 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.700 |