DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGLYRP1 and PGRP-LF

DIOPT Version :9

Sequence 1:NP_005082.1 Gene:PGLYRP1 / 8993 HGNCID:8904 Length:196 Species:Homo sapiens
Sequence 2:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster


Alignment Length:201 Identity:70/201 - (34%)
Similarity:109/201 - (54%) Gaps:13/201 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     4 RSMLLAWALPSLLRLGAAQ---------ETEDPACCSPIVPRNEWKA-LASECAQHLSLPLRYVV 58
            |..||.:.:..|:.:|.|.         .|..|.....|:.|:||.. ..|....||.||:..::
  Fly    21 RFELLYFCVILLMVVGLAAGYFMWMMSFSTHSPNKGLHILDRSEWLGEPPSGKYPHLKLPVSNII 85

Human    59 VSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAH-SGHLW 122
            :.|||...|.....|..:.:.:|.:|||:.||.|:|||||:|.||.:|.||||:..|.| :|  :
  Fly    86 IHHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDIGYNFLVGGDGQIYVGRGWHIQGQHVNG--Y 148

Human   123 NPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLI 187
            ..:|:.|:|:|.:::..|..:.|.||:.|:..||....|:.:|.:..||.:..|.|||.:|:.|:
  Fly   149 GAISVSIAFIGTFVNMEPPARQIEAAKRLMDEGVRLHRLQPDYHIYAHRQLSPTESPGQKLFELM 213

Human   188 QNWPHY 193
            ||||.:
  Fly   214 QNWPRF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGLYRP1NP_005082.1 PGRP 31..173 CDD:128941 52/143 (36%)
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 52/143 (36%)
PGRP 236..363 CDD:295442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152323
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6354
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.