DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGLYRP1 and PGRP-LA

DIOPT Version :9

Sequence 1:NP_005082.1 Gene:PGLYRP1 / 8993 HGNCID:8904 Length:196 Species:Homo sapiens
Sequence 2:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster


Alignment Length:167 Identity:52/167 - (31%)
Similarity:86/167 - (51%) Gaps:13/167 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    33 IVPRNEWKALASECAQHLSLPLR----YVVVSHTAGSS--CNTPASCQQQARNVQHYHMKTLGWC 91
            :|.|.:|.  ||:.:..|::||:    ||:::|....|  |:....|..:.|.:|...:...|..
  Fly   183 VVDREQWG--ASKNSHGLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDSAIAEKGLP 245

Human    92 DVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGV 156
            |:..||.:.|:|.:|.||||::...::.     .::.|:|||:|....|.|:.:...|.|||..|
  Fly   246 DIQSNFYVSEEGNIYVGRGWDWANTYAN-----QTLAITFMGDYGRFKPGPKQLEGVQFLLAHAV 305

Human   157 AQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHY 193
            |...:..:|.|......:.|.|||..:|..|:||||:
  Fly   306 ANRNIDVDYKLVAQNQTKVTRSPGAYVYQEIRNWPHF 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGLYRP1NP_005082.1 PGRP 31..173 CDD:128941 42/145 (29%)
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 42/145 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.