DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGLYRP1 and PGRP-SD

DIOPT Version :9

Sequence 1:NP_005082.1 Gene:PGLYRP1 / 8993 HGNCID:8904 Length:196 Species:Homo sapiens
Sequence 2:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster


Alignment Length:163 Identity:70/163 - (42%)
Similarity:96/163 - (58%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    32 PIVPRNEWKALASECA-QHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGY 95
            |||.|.||.|.....| ..:..||...|::||||.:|....:|.|..:|:|::.|....:.|:||
  Fly    21 PIVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQNLQNFQMSKQKFSDIGY 85

Human    96 NFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGA 160
            ::|||.:|.|||||..:..||.:|.. |..|:||:|:||:.:|.|..:|:.||:.||...|.|..
  Fly    86 HYLIGGNGKVYEGRSPSQRGAFAGPN-NDGSLGIAFIGNFEERAPNKEALDAAKELLEQAVKQAQ 149

Human   161 LRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHY 193
            |...|.|.|||.|..|.|||..||.|||.||::
  Fly   150 LVEGYKLLGHRQVSATKSPGEALYALIQQWPNW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGLYRP1NP_005082.1 PGRP 31..173 CDD:128941 58/141 (41%)
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 58/141 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152326
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.620

Return to query results.
Submit another query.