DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGLYRP1 and PGRP-SC2

DIOPT Version :9

Sequence 1:NP_005082.1 Gene:PGLYRP1 / 8993 HGNCID:8904 Length:196 Species:Homo sapiens
Sequence 2:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster


Alignment Length:163 Identity:77/163 - (47%)
Similarity:108/163 - (66%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    33 IVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNF 97
            |:.::||...::.....|:..|.|.|:.||||:.|:|.|:|..|.:|:|.|||.:|||.|:||||
  Fly    23 IISKSEWGGRSATSKTSLANYLSYAVIHHTAGNYCSTKAACITQLQNIQAYHMDSLGWADIGYNF 87

Human    98 LIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALR 162
            |||.||.||||||||..|||:.: ||..||||||:|||.....|...|.||:|||:..|::|.:.
  Fly    88 LIGGDGNVYEGRGWNVMGAHATN-WNSKSIGISFLGNYNTNTLTSAQITAAKGLLSDAVSRGQIV 151

Human   163 SNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRS 195
            |.|:|.|||.|..|..||..:::.|:.|.::::
  Fly   152 SGYILYGHRQVGSTECPGTNIWNEIRTWSNWKA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGLYRP1NP_005082.1 PGRP 31..173 CDD:128941 71/139 (51%)
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 71/139 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152331
Domainoid 1 1.000 147 1.000 Domainoid score I4515
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4200
Isobase 1 0.950 - 0 Normalized mean entropy S6354
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - mtm8604
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4719
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.650

Return to query results.
Submit another query.