DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGLYRP1 and PGRP-LE

DIOPT Version :9

Sequence 1:NP_005082.1 Gene:PGLYRP1 / 8993 HGNCID:8904 Length:196 Species:Homo sapiens
Sequence 2:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster


Alignment Length:176 Identity:74/176 - (42%)
Similarity:106/176 - (60%) Gaps:8/176 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    22 QETEDPACCSPIVPRNEWKALASECAQH---LSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHY 83
            |:.:.|...|.|:||:.|  ||.:....   |.||::|||:.|||..|....|...:..|::|.:
  Fly   166 QKFKIPKELSAIIPRSSW--LAQKPMDEPLPLQLPVKYVVILHTATESSEKRAINVRLIRDMQCF 228

Human    84 HMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHS-GHLWNPMSIGISFMGNYMDRVPTPQAIRA 147
            |:::.||.|:.||||:|.||.:||||||...|||: |  :|.:|:||||:|.:|..:||..|:..
  Fly   229 HIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAHTLG--YNRISLGISFIGCFMKELPTADALNM 291

Human   148 AQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHY 193
            .:.|||.||..|.:.::|.|..|.....|.|||.:||..||.|||:
  Fly   292 CRNLLARGVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGLYRP1NP_005082.1 PGRP 31..173 CDD:128941 61/145 (42%)
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 61/145 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152325
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.