DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGLYRP1 and PGRP-SA

DIOPT Version :9

Sequence 1:NP_005082.1 Gene:PGLYRP1 / 8993 HGNCID:8904 Length:196 Species:Homo sapiens
Sequence 2:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster


Alignment Length:188 Identity:76/188 - (40%)
Similarity:110/188 - (58%) Gaps:2/188 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     8 LAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPAS 72
            |...|.:.:..|.::: ..||.|..|..:.:|....|....:...|:||||:.||....|:....
  Fly    16 LVLLLLAFVSAGKSRQ-RSPANCPTIKLKRQWGGKPSLGLHYQVRPIRYVVIHHTVTGECSGLLK 79

Human    73 CQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMD 137
            |.:..:|:|.||...|.:.|:.||||||.||:||||.||...|||: :.:|.:..||:|:||::|
  Fly    80 CAEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHT-YGYNAIGTGIAFIGNFVD 143

Human   138 RVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRS 195
            ::|:..|::||:.||||||.||.|..:|.|.....|..|.|||..||:.||.|||:.|
  Fly   144 KLPSDAALQAAKDLLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHWLS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGLYRP1NP_005082.1 PGRP 31..173 CDD:128941 57/141 (40%)
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 57/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm41991
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1649
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.