DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX4 and Lhx4

DIOPT Version :9

Sequence 1:NP_203129.1 Gene:LHX4 / 89884 HGNCID:21734 Length:390 Species:Homo sapiens
Sequence 2:NP_001101818.2 Gene:Lhx4 / 360858 RGDID:1308044 Length:390 Species:Rattus norvegicus


Alignment Length:390 Identity:383/390 - (98%)
Similarity:386/390 - (98%) Gaps:0/390 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLA 65
            |||||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MMQSAAVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLA 65

Human    66 DRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEF 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    66 DRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEF 130

Human   131 YLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETG 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   131 YLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETG 195

Human   196 LDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFRE 260
            |||||||||||||||||||||||||||||||||||||||||.|||||||||||||||||||||||
  Rat   196 LDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGGSKQEKESSAEDCGVSDSELSFRE 260

Human   261 DQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAP 325
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   261 DQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAP 325

Human   326 LLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPF 390
            ||:|||||||||||:|||.||||||||||||||||||:|||||||||||||||.|||||||||||
  Rat   326 LLSGLDYTVDSNLGVIAHPGQGVSQTLRAMAGGPTSDLSTGSSVGYPDFPTSPASWLDEMDHPPF 390

Human   391  390
              Rat   391  390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX4NP_203129.1 LIM1_Lhx4 30..81 CDD:188852 50/50 (100%)
LIM2_Lhx3_Lhx4 89..144 CDD:188762 54/54 (100%)
Homeobox 160..213 CDD:306543 52/52 (100%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 161..181 19/19 (100%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 199..211 11/11 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..253 21/22 (95%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..390 31/33 (94%)
Lhx4NP_001101818.2 LIM1_Lhx4 30..81 CDD:188852 50/50 (100%)
LIM2_Lhx3_Lhx4 89..144 CDD:188762 54/54 (100%)
Homeobox 160..214 CDD:395001 53/53 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 354 1.000 Domainoid score I12612
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56497
Inparanoid 1 1.050 782 1.000 Inparanoid score I7739
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG41153
OrthoDB 1 1.010 - - D100750at40674
OrthoFinder 1 1.000 - - FOG0002911
OrthoInspector 1 1.000 - - oto131398
orthoMCL 1 0.900 - - OOG6_106440
Panther 1 1.100 - - LDO PTHR24208
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1144
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1515.480

Return to query results.
Submit another query.