DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC12 and wrk-1

DIOPT Version :9

Sequence 1:NP_443729.1 Gene:SIGLEC12 / 89858 HGNCID:15482 Length:595 Species:Homo sapiens
Sequence 2:NP_001024651.1 Gene:wrk-1 / 181093 WormBaseID:WBGene00006942 Length:452 Species:Caenorhabditis elegans


Alignment Length:245 Identity:51/245 - (20%)
Similarity:81/245 - (33%) Gaps:53/245 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   379 ASTTLR---NGSALSVLEGQSLHLVCAVDSNPPARLSW---------------TWGSLTLSPSQS 425
            |||:.:   .|..|...||:||.|.|.|: :|...:.|               |:|...:|...|
 Worm    14 ASTSAQIRTKGGTLIAKEGESLTLRCEVE-DPSVAIIWRKNTEVVAVDDEILDTYGGYEISMEGS 77

Human   426 SNLGVLELPRVHVKDEGEFTCRAQNPLGSQHISLSLSLQNEYTGKMRPI------SGVTLGAFGG 484
            ::  ||.:.||...:...::|....|..|....:.:.:.......::|:      :||.....|.
 Worm    78 TS--VLTIKRVEPINSANYSCALAEPEVSVTFVIKVQVFKPTQVSVKPLVVISPDTGVYHARVGE 140

Human   485 AGATALVFLYFCIIFVVVRSCRKKSARPAVGVGDTGM-----EDANAVRGSASQGPLIESPADDS 544
            ..              :|.:|..|...|..||..|..     ||.....|.|      .....:.
 Worm   141 KN--------------LVITCHVKEGNPKPGVVWTKQAAKLPEDIKREHGGA------RIVITEV 185

Human   545 PPHHAPPALATPSPEEGEIQYASLSFHKARPQYPQEQEAIGYEYSEINIP 594
            ..|||...........|. ..|::..|.|.|...:.:|....:..:..||
 Worm   186 KKHHAGKYNCLAENIAGS-DRATIDIHVAEPLQGEREEKPWVKNEDTFIP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC12NP_443729.1 Ig 24..142 CDD:325142
Ig 151..269 CDD:325142
Ig 232..345 CDD:325142
IG_like 389..462 CDD:214653 21/87 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 512..560 11/52 (21%)
ITIM motif 563..568 1/4 (25%)
SLAM-like motif 586..591 0/4 (0%)
wrk-1NP_001024651.1 IG_like 25..113 CDD:214653 21/90 (23%)
IGc2 31..96 CDD:197706 17/67 (25%)
IG_like 132..212 CDD:214653 19/100 (19%)
IGc2 142..202 CDD:197706 14/79 (18%)
IG_like 235..320 CDD:214653 51/245 (21%)
Ig 245..318 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.