DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chi3l1 and Cht10

DIOPT Version :9

Sequence 1:NP_001296749.1 Gene:Chi3l1 / 89824 RGDID:620874 Length:391 Species:Rattus norvegicus
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:381 Identity:151/381 - (39%)
Similarity:226/381 - (59%) Gaps:32/381 - (8%)


- Green bases have known domain annotations that are detailed below.


  Rat    28 SAYKLVCYYTNWSQYREGNGSCFPDALDHSLCTHIIYSFANISNNKL---STSEWNDV--TLYGM 87
            |.||::||:|||:.||:|.|...||.::..||||:||.||.:..::|   :...|.||  ..|..
  Fly   963 SHYKVICYFTNWAWYRKGIGRFTPDDINTELCTHVIYGFAVLDYSELVLRTHDSWADVENNFYTR 1027

  Rat    88 LNTLKTRNPRLKTLLSVGGWSFG-SERFSRIVSNAKSRKTFVQSVAPFLRTYGFDGLDLAWLYP- 150
            :.:||::.  :|..|::|||:.. .:::||:|.:..:|..||:....|:..|||:||||.|.|| 
  Fly  1028 VTSLKSKG--IKVSLALGGWNDSQGDKYSRLVRSPMARSRFVRHALEFIEKYGFEGLDLDWEYPV 1090

  Rat   151 ---------GPKDKQHFTTLIKELKAEFTKEVQPGTEKLLLSAAVSAGKVTLDSGYDVAQIAQHL 206
                     ..::|..||..::||...|    :|  ..|:||.|||..:..:|:|||:.|::::.
  Fly  1091 CWQTECNKGSTEEKDGFTAWVQELSEAF----RP--RGLMLSTAVSPSRKIIDAGYDIPQLSRYF 1149

  Rat   207 DFINLMTYDFHGTWRHTTGHHSPLFRGQQDTGPDRFSNVDYGVGYMLRLGAPTNKLVMGIPTFGK 271
            |:|.:|||||||.|...|||.:||:....|  ...:.||:|.:.|.:..|||:.|||||||.:|:
  Fly  1150 DWIAVMTYDFHGHWDKKTGHVAPLYHHPDD--DFEYFNVNYSINYWMEKGAPSQKLVMGIPLYGQ 1212

  Rat   272 SFTLASSENQ-VGAPITGSGLPGRYTKEKGTLAYYEICDFL--RGAE-VHRILGQQVPFATKGNQ 332
            ||||.::.:. :.|.....|..|.:|:..|.|||||||:.:  :|.: ||...|:..|:|.||.|
  Fly  1213 SFTLENTNSSGLNAKAPAPGEAGEFTRAAGFLAYYEICERVNRQGWQVVHDEFGRMGPYAYKGTQ 1277

  Rat   333 WVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFCGHNVHFPLTNAIKEAL 388
            ||.||.|:.|:.|...:::.:|.|.||||:|||||:.. ||:.|| ||...|...|
  Fly  1278 WVSYDSPDMVRKKSLLVRSLKLGGGMVWALDLDDFKNR-CGNGVH-PLLTEIHNVL 1331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chi3l1NP_001296749.1 Glyco_18 31..365 CDD:214753 137/353 (39%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 147/375 (39%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753 137/353 (39%)
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351 147/375 (39%)
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9066
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.