DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Angpt2 and CG31832

DIOPT Version :9

Sequence 1:NP_604449.1 Gene:Angpt2 / 89805 RGDID:621861 Length:496 Species:Rattus norvegicus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:241 Identity:79/241 - (32%)
Similarity:111/241 - (46%) Gaps:50/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Rat   264 SPDYKSSVAVPKEE-------KTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEVKAYCDMDMGGGG 321
            ||:....:.:|:||       |||.||                                      
  Fly    29 SPNGIHQLMLPEEEPFQVTQCKTTARD-------------------------------------- 55

  Rat   322 WTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTSGHRYVLKIQLKDWEGSEAHSL 386
            |.|||.|.||||:|.::|..||:|||.|.||:::|.:.:..:|....:.|.||||...|:..::.
  Fly    56 WIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAH 120

  Rat   387 YEHFYLSGEESNYRIHLTG-LTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLTGGWWFDAC 450
            ::.|.:..|...|::...| .:||||. |........|||.|.|||:....|:....|||||.:|
  Fly   121 FDDFQVDSETELYKLERVGKYSGTAGD-SLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSC 184

  Rat   451 GPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF 496
            ..|:|||.|: ::..|...|||.|..||..  ||....:||||..|
  Fly   185 LSSSLNGLYF-REGETGMLNGIHWGRWKFQ--SLTFVQIMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Angpt2NP_604449.1 Mplasa_alph_rch <78..>232 CDD:275316
FBG 280..494 CDD:214548 70/214 (33%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 77/237 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.