DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Angpt2 and CG31832

DIOPT Version :10

Sequence 1:NP_604449.1 Gene:Angpt2 / 89805 RGDID:621861 Length:496 Species:Rattus norvegicus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:241 Identity:79/241 - (32%)
Similarity:111/241 - (46%) Gaps:50/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Rat   264 SPDYKSSVAVPKEE-------KTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEVKAYCDMDMGGGG 321
            ||:....:.:|:||       |||.||                                      
  Fly    29 SPNGIHQLMLPEEEPFQVTQCKTTARD-------------------------------------- 55

  Rat   322 WTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTSGHRYVLKIQLKDWEGSEAHSL 386
            |.|||.|.||||:|.::|..||:|||.|.||:::|.:.:..:|....:.|.||||...|:..::.
  Fly    56 WIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAH 120

  Rat   387 YEHFYLSGEESNYRIHLTG-LTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLTGGWWFDAC 450
            ::.|.:..|...|::...| .:||||. |........|||.|.|||:....|:....|||||.:|
  Fly   121 FDDFQVDSETELYKLERVGKYSGTAGD-SLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSC 184

  Rat   451 GPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF 496
            ..|:|||.|: ::..|...|||.|..||..  ||....:||||..|
  Fly   185 LSSSLNGLYF-REGETGMLNGIHWGRWKFQ--SLTFVQIMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Angpt2NP_604449.1 Mplasa_alph_rch <78..>232 CDD:275316
FBG 280..494 CDD:214548 70/214 (33%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 77/237 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.