DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC10 and LOC101884840

DIOPT Version :9

Sequence 1:NP_149121.2 Gene:SIGLEC10 / 89790 HGNCID:15620 Length:697 Species:Homo sapiens
Sequence 2:XP_021322151.1 Gene:LOC101884840 / 101884840 -ID:- Length:692 Species:Danio rerio


Alignment Length:231 Identity:57/231 - (24%)
Similarity:93/231 - (40%) Gaps:50/231 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    25 VQESVMVPEGLCISVPCSFSYP-------RQDWTGSTPAYGYWFKAVTETTKGAPVATNHQSREV 82
            :.|...:|.. |:.:|||||..       |..|..:...|.|....|                :|
Zfish   332 IPEITALPRS-CVVIPCSFSVEHKYLTGLRVRWVNNNGGYMYHTDPV----------------DV 379

Human    83 EMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQYFFRVERGSYVRYNFMNDGFFLKVTALTQKPD 147
            ..:.:||.:|.|:|.:.||:|.:.|.:..|...:.|:.|: ...:|:|.|...|:.:.|...:|.
Zfish   380 LDNFKGRTRLLGNPDERNCTLEMDDVRTHDNGPFCFQAEK-KEEKYSFNNSCVFIIMRASPDQPV 443

Human   148 V-YIPETLEPGQPVTVICVFNWAFEECP--PPSFSWTGAALSSQGTKPTTSH----------FSV 199
            : .:||.:|||..|||.|...   ..|.  ||..:|     |....:.|.||          .|.
Zfish   444 MSSVPEDIEPGTAVTVKCSVK---HTCSSHPPKITW-----SVPTVRETISHNPMGGGVWETVSK 500

Human   200 LSFTPRPQDHNTDLTCHVDF----SRKGVSAQRTVR 231
            :.|.|...:...::.|..:|    ::...||..:|:
Zfish   501 MKFIPTGYEEEDEIICSANFWGGKTQSNSSAPLSVK 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC10NP_149121.2 Ig 23..140 CDD:299845 30/121 (25%)
IG_like 26..126 CDD:214653 26/106 (25%)
IG_like 262..340 CDD:214653
IGc2 269..330 CDD:197706
IG_like 367..442 CDD:214653
Ig 378..439 CDD:143165
LOC101884840XP_021322151.1 Ig 1..>83 CDD:325142
Ig 226..307 CDD:325142
Ig 335..426 CDD:325142 26/108 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I12412
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.