DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC10 and si:ch73-380l3.2

DIOPT Version :9

Sequence 1:NP_149121.2 Gene:SIGLEC10 / 89790 HGNCID:15620 Length:697 Species:Homo sapiens
Sequence 2:NP_001348166.1 Gene:si:ch73-380l3.2 / 100003913 ZFINID:ZDB-GENE-080303-1 Length:266 Species:Danio rerio


Alignment Length:227 Identity:63/227 - (27%)
Similarity:96/227 - (42%) Gaps:30/227 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    22 W-IRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAY---GYWFKAVTETTKGAPVATNHQSREV 82
            | :.|:..:......|:.:||:|:||...  ...|:|   |.|.|    ..|...:........|
Zfish    24 WKVDVEHKMKALVSSCVVLPCNFTYPVHQ--QQQPSYRIRGIWHK----MNKWDDIIFYGDKTLV 82

Human    83 EMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQYFFRV--ERGSYVRYNFMNDGFFLKVTALTQK 145
            |.:.:||.:|.|.....||||.|.:.:..|...|.|||  |.....:|:|:::...:.......|
Zfish    83 EDNFKGRTRLIGSLGSFNCSLEIDEVKNTDNGPYCFRVELETAPKDKYSFVDNCVSITTIEEAPK 147

Human   146 PDVYIPETLEPGQPVTVICVFNWAFEECP--PPSFSW--TGAALSSQGTKPTTSH-----FSVLS 201
            |.:....::..|:|....|...   ..||  .|||||  .|..:||..   ...|     .|:|:
Zfish   148 PMLEAETSVLEGEPAIFKCSVR---HTCPTYQPSFSWNRAGKIISSYN---DLGHGNWEAESLLT 206

Human   202 FTPRPQDHNTDLTCHVDF--SRKG-VSAQRTV 230
            |||..:|:.|.:.|.|.:  :.|| :.|.|.|
Zfish   207 FTPTKEDNYTSIECTVKYHGNVKGEMKASRPV 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC10NP_149121.2 Ig 23..140 CDD:299845 32/121 (26%)
IG_like 26..126 CDD:214653 29/104 (28%)
IG_like 262..340 CDD:214653
IGc2 269..330 CDD:197706
IG_like 367..442 CDD:214653
Ig 378..439 CDD:143165
si:ch73-380l3.2NP_001348166.1 Ig 24..141 CDD:325142 33/122 (27%)
Ig 148..226 CDD:325142 24/83 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I12412
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.