DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSPH1 and CG3222

DIOPT Version :10

Sequence 1:NP_543136.1 Gene:RSPH1 / 89765 HGNCID:12371 Length:309 Species:Homo sapiens
Sequence 2:NP_648333.1 Gene:CG3222 / 39114 FlyBaseID:FBgn0036014 Length:379 Species:Drosophila melanogaster


Alignment Length:320 Identity:60/320 - (18%)
Similarity:98/320 - (30%) Gaps:118/320 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    49 EFGKRHGQGIYKFKNGARYIGEYVR--NKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINND 111
            |..:||      |...:.|.|.:.|  |...|.|::.|||||.|.|.:.....||:|        
  Fly     7 ETQQRH------FITRSSYEGAWDRLVNVMDGFGSYRYPDGSEYRGRFHQGQFHGYG-------- 57

Human   112 TYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAELIHLNHRYQGKFL------------ 164
                    |.|..| .|.:...|....|..|..:....::.:|::.|:.|..|            
  Fly    58 --------HLRLAQ-PYRFTVKGEFEHGRLVTVEDMWFSDGLHVDGRFNGMVLQCDEWDYLTPKD 113

Human   165 ---------NKNPVGPGKYV-------------FD-------------------------VGCEQ 182
                     .:.||||..::             :|                         |.|.|
  Fly   114 RRYHAERRYGQQPVGPTAFLTSKMQPRNIPEHCYDVEEGLFNSKTCWLTDRPSPLHQFMYVSCPQ 178

Human   183 HGEY-----RLTDMERGEEEEEEELVTVVPKWKAT---QITELALWTPT-----------LPKKP 228
            ..::     |.....|..|...:....::....||   |:...|::.|.           |.||.
  Fly   179 DKDWIKKNCRKARTSRIIEPPSDFCRRIIANNLATERAQLRSTAIYAPNGQVDRERYFHKLTKKR 243

Human   229 TSTDGPGQDAPGAE-SAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFR 287
            ...:.|.::.|... ...:|..|.:..:..:.|.:|              .::.||.||:
  Fly   244 GQPNEPLENIPRRPMPVDDPAWETEMCVRAYAGMLD--------------KQQKDQMEFK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSPH1NP_543136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
COG4642 <15..176 CDD:443680 35/162 (22%)
MORN 1 20..43
MORN 2 44..66 4/16 (25%)
MORN 3 67..89 10/23 (43%)
MORN 4 90..112 5/21 (24%)
MORN 5 113..135 4/21 (19%)
MORN 6 159..181 8/80 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..309 14/78 (18%)
CG3222NP_648333.1 COG4642 <17..97 CDD:443680 25/96 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.