DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSPH1 and CG14490

DIOPT Version :10

Sequence 1:NP_543136.1 Gene:RSPH1 / 89765 HGNCID:12371 Length:309 Species:Homo sapiens
Sequence 2:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster


Alignment Length:160 Identity:55/160 - (34%)
Similarity:87/160 - (54%) Gaps:15/160 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    18 GEYEG---GRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFK--NGAR---YIGEYVRN 74
            |:|:|   |:    :.||.|..:..:|..|||.::.|:|||.|..:.|  :|..   |:|::..|
  Fly    20 GQYQGKWLGQ----QPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWREN 80

Human    75 KKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVG 139
            |:.|:|...|||||.|.|:|..|.|.|.|:.:..:...|.|||...:.|.:| .|:..||::|||
  Fly    81 KRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKG-LLFTATGNRYVG 144

Human   140 TWVNGQQEGTAELIHLNH--RYQGKFLNKN 167
            .:..|.:.|:....|.::  |.|..|.:|:
  Fly   145 QFEGGCKSGSGVFYHASNGQRIQHGFWSKD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSPH1NP_543136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 7/26 (27%)
COG4642 <15..176 CDD:443680 55/160 (34%)
MORN 1 20..43 7/25 (28%)
MORN 2 44..66 10/23 (43%)
MORN 3 67..89 10/21 (48%)
MORN 4 90..112 7/21 (33%)
MORN 5 113..135 8/21 (38%)
MORN 6 159..181 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..309
CG14490NP_611274.1 COG4642 <18..173 CDD:443680 54/157 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.