DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P4HA2 and CG34345

DIOPT Version :9

Sequence 1:NP_001136071.1 Gene:P4HA2 / 8974 HGNCID:8547 Length:535 Species:Homo sapiens
Sequence 2:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster


Alignment Length:546 Identity:145/546 - (26%)
Similarity:239/546 - (43%) Gaps:76/546 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     4 WVSALLMAWFGVLSCVQAE--------FFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKS 60
            |:   |:..|.|....:||        :..||..:::|...|...::.|..|:...:.|:..::.
  Fly    13 WI---LLFLFTVCKAKKAENDVVQEVIYSNSIRALSELREIENSYMEHLNNYVSFLQQKIKTLRI 74

Human    61 WANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFI------ANLSVQ 119
            :.|.:.........|...|:::|:|::.|::|.:.|||.| ...|:|.  |.|      .|..:.
  Fly    75 FINSLTPNYLDHKVDRYKYVSNPLNSFGLLRRAHQDWPKL-IAYLKDQ--GNIKVDIEEMNKLIN 136

Human   120 RQFFPTDEDEIGAAKALMRLQDTYRLDPGTISRGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYH 184
            |.....|.:|  |...:.|::..|.|....:::|.:.|.:..:.:|..||..:....|...::..
  Fly   137 RTPHANDMEE--ALMGMDRIEHFYDLKSSDMAQGLVAGQQLSSRMSASDCLALADYMYKRSEFRR 199

Human   185 TVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRY 249
            ...|....|...      |..|:.:. :..||. :..:|.:...::|                  
  Fly   200 AAEWYRIALSVF------TKPKNNIA-FKFYAP-KRKELEKMFVISR------------------ 238

Human   250 FEQLLEEEREKTLTNQTEAELATPEG--IYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCR 312
                |:|...:.||:..:.....|..  ::.||   .....:.|..|:|   |..|..|  |.||
  Fly   239 ----LQEGSVENLTDCLKELSQDPNNSLVHLRP---RKSPTMIEQGCQG---KFPPGPQ--LVCR 291

Human   313 YHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVA 377
            | :....|.:.|||.|||:....|.|..|:||:.|.||.::..:.:.::...|..:..|      
  Fly   292 Y-NSTTTPFMRIAPLKEEEISRDPLIWLYHDVIYDSEIAQLTNVTREEMILGTTTNYTT------ 349

Human   378 SYRVSKSSWLEEDDD---PVVARVNRRMQHITGLTVKTAELLQVANYGVGGQYEPHFDFSRNDER 439
            ..||::...::..||   .:...:..||..|:||.|.....|...|||:||.::.|.|:.   :.
  Fly   350 PDRVNRLFHIKVTDDDGGKLDKTLVNRMADISGLDVGNTTTLARINYGLGGYFQEHSDYM---DI 411

Human   440 DTFKHL-GTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYRTRHAA 503
            ..:..| ..|:|:.|||.||:||..||.|:||....||.||||:|:|||||..:|:.:..||||.
  Fly   412 KLYPELTEEGDRLMTFLFYMTDVPVGGTTIFPGAQLAIQPKKGSALFWYNLHNNGDPNLLTRHAV 476

Human   504 CPVLVGCKWVSNKWFHERGQEFLRPC 529
            ||.:||.:||..|......|.|.:||
  Fly   477 CPTIVGSRWVLVKSMLNYEQMFKKPC 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P4HA2NP_001136071.1 P4Ha_N 26..155 CDD:311993 31/134 (23%)
TPR 207..240 4/32 (13%)
P4Hc 346..519 CDD:214780 62/176 (35%)
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528 31/134 (23%)
P4Hc 324..489 CDD:214780 61/173 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.