DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P4HA2 and CG15864

DIOPT Version :9

Sequence 1:NP_001136071.1 Gene:P4HA2 / 8974 HGNCID:8547 Length:535 Species:Homo sapiens
Sequence 2:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster


Alignment Length:540 Identity:144/540 - (26%)
Similarity:240/540 - (44%) Gaps:110/540 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    15 VLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTSKSAADAEGY 79
            |.|..:..:..|...:..|:..|.|||.:||.|:...:.|.:.::.....|.....:..:|.|.|
  Fly    24 VKSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMKSDYESY 88

Human    80 LAHPVNAYKLVKRLNTDWPALED--LVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQDT 142
            |.:|:|:::|:.||:|.|.....  :.::::|.|.|.|..:.|:..||..|...|.:.:..|...
  Fly    89 LGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKMLPTSSDLQQACRGIHDLMSF 153

Human   143 YRLDPGTISRGEL-----PGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEA 202
            |.|.|..::.|.|     |||.    |:..||..:|..:               |.|:.|...||
  Fly   154 YDLKPEELAAGNLAGYSQPGTG----LTAYDCLALGEFS---------------VQKREDDLAEA 199

Human   203 TTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKT-----L 262
            ....|.:.....:..::   :|:|..|                       ||.:.::.|     .
  Fly   200 WYNLSLIRFENKFDKYR---VHKAWGL-----------------------LLAKNKQLTDAFYHF 238

Human   263 TNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPF 327
            .|:.|..:|:.|.|:.:           |.|...:...:..::..||.||| :....|...|||.
  Fly   239 ENKPEGIIASNEVIHFK-----------EELSTKQNCAVVVQKPSRLHCRY-NTTTTPFTRIAPL 291

Human   328 KEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASY------------- 379
            |.|:....|::|.::||:.|.||:                    |:|..:::             
  Fly   292 KMEELGLDPYMVVFHDVIYDTEID--------------------GMLNSSNFGLSLTDSGQKSEV 336

Human   380 RVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVANYGVGGQYEPHFDFSRNDERDTFKH 444
            |.||.|::.:     ...:|.|:..:||.:::.::...:.|||:||.|..|:||.........|.
  Fly   337 RTSKDSYIVD-----AKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQ 396

Human   445 LGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYRTRHAACPVLVG 509
               |:|:||.|.|:.:|::||||:||.:...:.||||:|||||||..||..:.::.|:||||:.|
  Fly   397 ---GDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISG 458

Human   510 CKWVSNKWFHERGQEFLRPC 529
            .|:|..||.:|..|.|:.||
  Fly   459 SKYVLTKWINELPQMFVTPC 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P4HA2NP_001136071.1 P4Ha_N 26..155 CDD:311993 36/130 (28%)
TPR 207..240 4/32 (13%)
P4Hc 346..519 CDD:214780 59/185 (32%)
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528 36/130 (28%)
metallo-dependent_hydrolases <237..>306 CDD:294200 20/80 (25%)
P4Hc 313..467 CDD:214780 57/181 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.