DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P4HA2 and CG31371

DIOPT Version :9

Sequence 1:NP_001136071.1 Gene:P4HA2 / 8974 HGNCID:8547 Length:535 Species:Homo sapiens
Sequence 2:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster


Alignment Length:523 Identity:134/523 - (25%)
Similarity:234/523 - (44%) Gaps:71/523 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     3 LWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEA 67
            ||   ||..:..|.|...|.|......:..|:..|.:|:..|::||...|.:|.:|:...:.:|.
  Fly     8 LW---LLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEE 69

Human    68 LTSKSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGA 132
            :.|: ....|.|:.:|:|.:.::||..:.||.||..........|...||.::...|::||...:
  Fly    70 IHSQ-VDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEES 133

Human   133 AKALMRLQDTYRLDPGTISRGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLD 197
            ...|:.||..|.||..::|.|.:.|.|..:.:|..||..:.|    :.|:.....|:|..|::|.
  Fly   134 LNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALEKLP 194

Human   198 AGEEATTTKSQ---------VLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQ- 252
            :..| .:|:||         :|:......::.|:|.|||.....||.|.|.::......|..|: 
  Fly   195 SASE-NSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKA 258

Human   253 LLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHH-- 315
            :.::|..|....:::|         ::.:....|:.:.|.:|||      .::|.....|::|  
  Fly   259 MAKKELPKGRGQKSKA---------KKQISKSTEQLLIEEICRG------AKQQVTTGSRFNHCQ 308

Human   316 -GNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASY 379
             ...:|.||:.|.:.|.....|:||.::||::.:|...:.::...:      .|.| ||    ||
  Fly   309 LDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEE------EDTK-GV----SY 362

Human   380 RVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVANYGVGGQYEPHFDFSRNDERDTFKH 444
            :..|.|.|.:..   :.|::|    :.||     |:|::..:  .|:...|...::.:.....||
  Fly   363 QSLKLSKLAQKK---LGRISR----LLGL-----EILELDPW--TGRRHGHEHITKLEHSSELKH 413

Human   445 LGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSG---EGDYRTRHAACPV 506
                  ||..:..:.....|||.|||.|..|:...:|:.:.|......|   |.|||:..|.|||
  Fly   414 ------VARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPV 472

Human   507 LVG 509
            |:|
  Fly   473 LLG 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P4HA2NP_001136071.1 P4Ha_N 26..155 CDD:311993 35/128 (27%)
TPR 207..240 12/41 (29%)
P4Hc 346..519 CDD:214780 43/167 (26%)
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 35/126 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391515at2759
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.