DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P4HA2 and CG18749

DIOPT Version :9

Sequence 1:NP_001136071.1 Gene:P4HA2 / 8974 HGNCID:8547 Length:535 Species:Homo sapiens
Sequence 2:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster


Alignment Length:573 Identity:157/573 - (27%)
Similarity:243/573 - (42%) Gaps:144/573 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     2 KLWVSALLMAWFGVLSC-------VQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIK 59
            ||.....|.|.|  ::|       .:..:..|...:..|:..|.|||.:||.|:...:.|.:.::
  Fly     6 KLTFIGFLSACF--INCQGFVNSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLME 68

Human    60 SWANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDWPALED--LVLQDSAAGFIANLSVQRQF 122
            .....|.....:..:|.|.||.:|:|:::|:.||:|.|.....  :.::::|.|.|.|..:.|:.
  Fly    69 RSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKM 133

Human   123 FPTDEDEIGAAKALMRLQDTYRLDPGTISRGEL-----PGTKYQAMLSVDDCFGMGR-SAYNEGD 181
            .||..|...|.:.:..|...|.|.|..::.|.|     |||.    |:..||..:|. ...|:.|
  Fly   134 LPTSSDLQQACRGIHDLMYFYDLKPEELAAGNLAGYSQPGTG----LTAYDCLALGEFGVQNQKD 194

Human   182 YYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRA---LELTRRLLSLDPSHERA 243
                                                    ||..|   |.|||            
  Fly   195 ----------------------------------------DLAEAWYNLSLTR------------ 207

Human   244 GGNLRYFEQLLEE-----------EREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGE 297
                  |:.::|:           .:.|.||...:.....||||.           ....:...|
  Fly   208 ------FDNIIEKYQVHKAWALLLAKNKQLTEAFQHFENKPEGIV-----------ASNEVIHFE 255

Human   298 GVKLTPRR--------QKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIK 354
            ||..|.:.        .|:|.||| :.:..|...|||.|.|:....|::|.::||:.|.||:   
  Fly   256 GVLATTQNCTAVVQKPSKKLHCRY-NTSTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEID--- 316

Human   355 EIAKPKLARATVRDPKTGVLTVASYRVSKS-SWLEED-----DDPVV--ARVNRRMQHITGLTVK 411
                             |:|..:.:.:|:| |.|:.:     |..:|  ..:|.|:..:|||:::
  Fly   317 -----------------GMLNSSDFGLSESVSGLKSEVRTSKDSHIVDAKTLNERVTDMTGLSME 364

Human   412 TAELLQVANYGVGGQYEPHFDFSRNDERDTFKHLGTGNRVATFLNYMSDVEAGGATVFPDLGAAI 476
            .::...:.|||:||.:..|.||   .|......|..|:|:||.|.|:.:|::|||||||.|...:
  Fly   365 MSDPFSLINYGLGGHFILHHDF---HEYTNTTRLKQGDRIATVLFYLREVDSGGATVFPMLNITV 426

Human   477 WPKKGTAVFWYNLLRSGEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPC 529
            .||||:|||||||..||..:.:|.|.||||:.|.|:|..||.:|..|.|:.||
  Fly   427 MPKKGSAVFWYNLHNSGAVNSKTLHTACPVISGSKYVLTKWINELPQMFVTPC 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P4HA2NP_001136071.1 P4Ha_N 26..155 CDD:311993 36/130 (28%)
TPR 207..240 7/35 (20%)
P4Hc 346..519 CDD:214780 65/180 (36%)
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528 36/130 (28%)
P4Hc 314..468 CDD:214780 63/176 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.