DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P4HA2 and PH4alphaNE3

DIOPT Version :9

Sequence 1:NP_001136071.1 Gene:P4HA2 / 8974 HGNCID:8547 Length:535 Species:Homo sapiens
Sequence 2:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster


Alignment Length:526 Identity:146/526 - (27%)
Similarity:245/526 - (46%) Gaps:89/526 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    22 EFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTSKSAADAEGYLAHPVNA 86
            ||..:.....||:..:.||:.:|..|....:.|.|::|..|.::......:....|.||.:|:::
  Fly    16 EFLDTESAKMDLMQLDVELIDNLMNYAEKIDEKASQLKRLAQELRQPLHSAKGREEEYLGNPLHS 80

Human    87 YKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQDTYRLDPGTIS 151
            :.|::.:..||..||:.:.:......|..|..:....|...|...|:.::.|:.:||.:.|..::
  Fly    81 FPLIRHMYQDWRYLEEFMKKPVGEEEIQFLRRKLPELPWQVDTEEASVSIFRIAETYGMMPWDMA 145

Human   152 RGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYA 216
            .|.:...::.:.|...|||.:.:..:..|.:...:.|:             |.:|:::.:..| .
  Fly   146 NGLIDNVRFNSTLPALDCFEVAKMYFKWGYFKQALQWI-------------TISKARMKEEYS-G 196

Human   217 VFQLGDLHR---ALELTRRLLSLDPSHERAGGNLRYFEQLLEE----EREKTLTNQTEAELATPE 274
            |:::..::|   ||...|.|:.||...|.       .|.||::    :...:|.:|.:   |.| 
  Fly   197 VYEVLGMNRQDVALLQARCLVELDRRDEA-------HEVLLDQPDLADNSISLLDQFK---ANP- 250

Human   275 GIYERPVDYLPE-RDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHI 338
              || .:|..|: .:.|:.|||.   ..:|...| |.|||:....| .|::||.|.|:....|||
  Fly   251 --YE-AIDSSPKLGEGYKRLCRS---SFSPNPSK-LHCRYNSTTSA-FLILAPLKMEEISLEPHI 307

Human   339 VRYYDVMSDEEIERIKEIAKPKL------------ARATVRDPKTGVLTVASYRVSKSSWLEEDD 391
            |.|:|::.|::|:::..:|:|.|            ||::.|.|..|                   
  Fly   308 VVYHDILPDKDIQQLITLAEPLLKPTEMFDDNKNEARSSYRTPLGG------------------- 353

Human   392 DPVVARVNRRMQHITGLTVKTAELLQVANYGVGGQYEPHFDF--SRNDERDTFKHLGTGNRVATF 454
             |::..:.:||:.||||.::....:.:..||.|..|..::||  .||.|..     |.|:|:|||
  Fly   354 -PLLDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESK-----GFGDRMATF 412

Human   455 LNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYR-----TRHAACPVLVGCKWVS 514
            :.|::|...|||||||.|...:..::|..:|||||    .||..     |.||||||..|.|||.
  Fly   413 MFYLNDAPYGGATVFPRLNVKVPAERGKVLFWYNL----NGDTHDMEPTTMHAACPVFHGSKWVM 473

Human   515 NKWFHE 520
            ..|.||
  Fly   474 TAWIHE 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P4HA2NP_001136071.1 P4Ha_N 26..155 CDD:311993 29/128 (23%)
TPR 207..240 9/35 (26%)
P4Hc 346..519 CDD:214780 62/191 (32%)
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 29/123 (24%)
P4Hc 316..478 CDD:214780 62/190 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.