DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHRNA6 and nAChRbeta1

DIOPT Version :9

Sequence 1:NP_004189.1 Gene:CHRNA6 / 8973 HGNCID:15963 Length:494 Species:Homo sapiens
Sequence 2:NP_523927.2 Gene:nAChRbeta1 / 38545 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster


Alignment Length:482 Identity:212/482 - (43%)
Similarity:303/482 - (62%) Gaps:40/482 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    34 EERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWD 98
            ||||...||..||:.||||:|::..|.|.|.:|..||.||:|.||||::|:|||.:|.||:|:||
  Fly    28 EERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQIMKSNVWLRLVWYDYQLQWD 92

Human    99 PMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDIT 163
            ..:|.||..||:|.||:|||||||:|||.|:::|..|:..|:...|.:.|.||||::|||.:|:|
  Fly    93 EADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSSCTIDVT 157

Human   164 FFPFDHQNCSLKFGSWTYDKAEIDLLIIGSK--VDMNDFWENSEWEIIDASGYKHDIKYNCCEEI 226
            :||||.|.|.:||||||::..::.|.:..:|  ||::|:|::..|:||:...|.:..:.:.....
  Fly   158 YFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSGTWDIIEVPAYLNVYEGDSNHPT 222

Human   227 YTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITE 291
            .||||:...|||..:|||:|||:|.:.||||.|||||||::.||||||.||:||||.||||::::
  Fly   223 ETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLLLVSK 287

Human   292 TIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMR 356
            .:|.||||:||:.:|||||.|..|:||:|||.::|.::|.|.||.||.:::::||..||..|.|:
  Fly   288 ILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRTHRMPMYIRSIFLHYLPAFLFMK 352

Human   357 WPLDKTR--------GTGSDAVPRGLARRPAK--------GKLASHGEPRHLKECFH--C---HK 400
            .| .|||        |....|.|......||:        |...|..|...|.:..|  |   .|
  Fly   353 RP-RKTRLRWMMEMPGMSMPAHPHPSYGSPAELPKHISAIGGKQSKMEVMELSDLHHPNCKINRK 416

Human   401 SNE-----LATSKRRLSHQPLQWVVENSEH---SPEVEDVINSVQFIAENMKSHNETKEVEDDWK 457
            .|.     |....||.|        |:|:.   |||......:|:||||::::.:...:..:|||
  Fly   417 VNSGGELGLGDGCRRES--------ESSDSILLSPEASKATEAVEFIAEHLRNEDLYIQTREDWK 473

Human   458 YVAMVVDRVFLWVFIIVCVFGTAGLFL 484
            |||||:||:.|::|.||...||.|:.:
  Fly   474 YVAMVIDRLQLYIFFIVTTAGTVGILM 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHRNA6NP_004189.1 Neur_chan_LBD 34..484 CDD:332142 212/480 (44%)
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 212/480 (44%)
Neur_chan_LBD 28..236 CDD:280998 98/207 (47%)
Neur_chan_memb 243..498 CDD:280999 109/263 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.