DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHOX2B and Drgx

DIOPT Version :9

Sequence 1:NP_003915.2 Gene:PHOX2B / 8929 HGNCID:9143 Length:314 Species:Homo sapiens
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:356 Identity:116/356 - (32%)
Similarity:151/356 - (42%) Gaps:127/356 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    58 PSLTPGSCS-----LGTLRDHQSSPYAAV-PYKLFTDHGGLNE----KRKQRRIRTTFTSAQLKE 112
            |:|.|  |.     |.|| |:   |:||. ||..::.|..:::    :|||||.|||||..||:|
  Fly     8 PALHP--CGPHPPRLPTL-DY---PFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEE 66

Human   113 LERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSGKKSD 177
            ||..||:|||||::|||:||:||:||||||||||||||||:||.|| ........:||.|     
  Fly    67 LETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAER-LKDEQRKRENGES----- 125

Human   178 SSRDDESKEAKSTDPDSTGGPGPNPNPTP------SCGANG------------------GGG--- 215
            ||..|:..:::.:.||.||....:.:..|      |..|||                  |||   
  Fly   126 SSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSHSRSPGGGMHL 190

Human   216 ------------------------------GGPSPAG-----------APGAAGPGGPG------ 233
                                          |.|||:|           ..|..||..|.      
  Fly   191 DSSDNERPLSSNQLTATPHSASQSLGSISAGSPSPSGMHREREHTPLVGGGGQGPSSPSNSRNTD 255

Human   234 -----GEP---GKGGAAAAAAAAAAAA--------------AAAAAAAAGGLAAAGGPGQGWAPG 276
                 |.|   ..|...||::..:|::              ::||||||.|....|..|.|    
  Fly   256 SPIEVGGPMSLTTGSRMAASSNNSASSTPTPTTPHAPQMPHSSAAAAAAFGSHIFGNFGGG---- 316

Human   277 PGPITSIPDSLGGPFASVLSSLQRPNGAKAA 307
                ::..||..| |..|||.......|.||
  Fly   317 ----SNASDSNCG-FRPVLSEQSAVAAAAAA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHOX2BNP_003915.2 Homeobox 102..155 CDD:395001 40/52 (77%)
polyalanine repeat 241..260 7/32 (22%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 40/51 (78%)
OAR 428..445 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.