DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHOX2B and PHDP

DIOPT Version :9

Sequence 1:NP_003915.2 Gene:PHOX2B / 8929 HGNCID:9143 Length:314 Species:Homo sapiens
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:180 Identity:77/180 - (42%)
Similarity:98/180 - (54%) Gaps:35/180 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     6 YSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTL 70
            |:.:..|:|:.|         |:..|...|.:|.|...::.|.|.       ....|.:.::|:.
  Fly    42 YNLMIDSSYKLC---------ANESAIRGSLNQESSLLFSKITTV-------SEFYPATHNIGSY 90

Human    71 RD--HQSSPYAAVPYKLFTDHG-GLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELA 132
            ..  |         .|.:.|.| .|.:|.|||||||||||.||.|||::|.||||||||||||:|
  Fly    91 NTDFH---------LKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIA 146

Human   133 LKIDLTEARVQVWFQNRRAKFRKQERAA-------AAAAAAAKNGSSGKK 175
            .|:.||||||||||||||||||||||.|       ::.....||..:|.|
  Fly   147 SKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVAGSK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHOX2BNP_003915.2 Homeobox 102..155 CDD:395001 43/52 (83%)
polyalanine repeat 241..260
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 42/51 (82%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6854
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505098at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm40710
orthoMCL 1 0.900 - - OOG6_109475
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3133
SonicParanoid 1 1.000 - - X2223
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.