DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC3 and CG6678

DIOPT Version :9

Sequence 1:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens
Sequence 2:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster


Alignment Length:342 Identity:91/342 - (26%)
Similarity:151/342 - (44%) Gaps:59/342 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     4 WGYWSLGQPGISTNLQGIVAE-PQVCGFI-SDRSVKEVACGGNHSVFLLEDGEVYTCGLNTKGQL 66
            |.|.:|.. |....|:|::.: |..|..: :..:::.:|...:|.:.||:.|::|......:.:|
  Fly    46 WRYAALAF-GRKLCLRGLLDDGPNECVTLEATGNIRALAAADSHCLVLLQSGQLYRVQPKLQAEL 109

Human    67 --------GHEREGNKPEQIGAL---ADQHIIHVACGESHSLALSDRGQLFSWGAGSDGQLGLMT 120
                    .....|.|....||.   :...|.|:|||...::|:|....::|             
  Fly   110 VAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSENCVYS------------- 161

Human   121 TEDSVAVPRLIQKLNQQ--TILQVSCGNWHCLALAADGQFFTWGKNSHGQLGLGKEFPSQASPQR 183
                  :|..:.:.:::  .:.|:.||:.|.:.|.|:|..||||....|||||. |...:.:||.
  Fly   162 ------IPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLA-ELRVEETPQL 219

Human   184 VRSLEGIPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKD---RESPCHVKLLRTQKVV 245
            :.:|.||.:.|:||||.||.|:|..|.::.||:|.:|||||...|.   .:.|....|.:.|.:.
  Fly   220 LEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLP 284

Human   246 YISC-----------------GEEHTAVLTKSGGVFTFGAGSCGQLGHDSMN-DEVNPRRVLE-- 290
            ..:|                 |..||.::.:.|.::..|....||||....: ..|:..:.||  
  Fly   285 ECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQALEGI 349

Human   291 LMGSEVTQIACGRQHTL 307
            .|...|..:.||...||
  Fly   350 TMNPTVDDVLCGPWSTL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC3NP_055421.1 RCC1 1 1..51 11/48 (23%)
ATS1 2..331 CDD:227511 91/342 (27%)
RCC1 2 52..101 13/59 (22%)
RCC1 3 102..154 7/53 (13%)
RCC1 4 156..207 24/50 (48%)
RCC1 5 208..259 17/70 (24%)
RCC1 6 261..311 15/50 (30%)
RCC1 313..377 CDD:366085
RCC1 7 313..366
HECTc 702..1048 CDD:238033
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 83/309 (27%)
RCC1_2 176..205 CDD:290274 11/28 (39%)
RCC1 192..241 CDD:278826 23/49 (47%)
RCC1_2 228..257 CDD:290274 13/28 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.