DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC3 and kibra

DIOPT Version :9

Sequence 1:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens
Sequence 2:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster


Alignment Length:320 Identity:66/320 - (20%)
Similarity:113/320 - (35%) Gaps:74/320 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   765 MFTYYQDSNLLWFSDTCFVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLK- 828
            ||...| ..|||..:    |:|...|......|. .:|:.:..|.|..|...|:..:..:..|| 
  Fly   161 MFDVKQ-QRLLWAQE----EYNHLKLAASRSSLC-SSSSSMSRHDPELLRADLMLARERVHQLKQ 219

Human   829 -------ELSPTEGRSLQELLDYPGEDV--EETFCLNFTICRESYGVIEQ----KKLIPGGDNVT 880
                   ::|.|| |.:..|... ||.:  .|..|.:..   |.:.:.|:    .|.:..|:.| 
  Fly   220 ELTHITNDISYTE-RGMNTLYSV-GEKINARENGCYDIA---EVHAIREEMLKVHKSLVSGEKV- 278

Human   881 VCKDNRQEFVDAYV---NYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNW 942
                 |:|.:.:.|   |.:.:..:.|..:..:|.|.:||.....:|          .|:|..|.
  Fly   279 -----REELMRSLVQIKNELGRQQISEENSDLASPFDRVCVASQTDL----------CGSSGENL 328

Human   943 E---ELEETAIYKGDYSATHPTVKLFW-------ETFHEFPLEKKKKFLLFLTGSDRIPIYGMAS 997
            .   ...|.|..|..|:.....:|...       |......||..|..:|.:...:::    :..
  Fly   329 NGGARFAEMAKTKWQYAEWRKHIKKLQQQLADHVERIEPGQLESDKDRILLIQEKEKL----LND 389

Human   998 LQIVIQSTASGEEYLPVAHTCYNLLD----------------LPKYSSKEILSARLTQAL 1041
            |..:...:.|.||...:..|.:.|.:                |..:..|::|..:|.:||
  Fly   390 LNSISLKSRSEEEKRVIHQTRHKLEEDLKEAYEANNTCVANRLRFHEEKQLLLDKLQEAL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511
RCC1 2 52..101
RCC1 3 102..154
RCC1 4 156..207
RCC1 5 208..259
RCC1 6 261..311
RCC1 313..377 CDD:366085
RCC1 7 313..366
HECTc 702..1048 CDD:238033 66/320 (21%)
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809
C2_Kibra 693..813 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.