DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC3 and hyd

DIOPT Version :9

Sequence 1:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens
Sequence 2:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster


Alignment Length:893 Identity:174/893 - (19%)
Similarity:299/893 - (33%) Gaps:272/893 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   227 EKDRESPCHVK----LLRTQKVVYISCGEEHTAVLTKSGGVFTFGAGSCGQLGHDSMNDEVNPRR 287
            |.|...|...|    |:.|:..|.|:..:...:..|.:..|.....|||.:    :::.::|...
  Fly  2181 ETDDSLPSTSKSTEALMATRPEVIIAPNKASVSPATAARSVIVLAGGSCLK----TIDSDINNYS 2241

Human   288 VLELMGSEVTQIACGRQ-------HTLAF--------------VPSSGLIYA--------FGCGA 323
            ...|..:|  |..|..|       |.|.|              :||...:.:        ||...
  Fly  2242 ASNLSTAE--QAKCDTQYQKSTSDHLLLFPARGSQFYQSNFSELPSWNFLLSRWKLTLDLFGRVF 2304

Human   324 RGQLGTGHTCNVKCPSPVKGYWAAHSGQLSARADRFKYHIVKQIFSGGDQTFVLCSKYENYSPAV 388
            ...:|..|...:   ..::|:        ..:..||:.|:.| :.:|..:..|||....|     
  Fly  2305 MDDVGMEHGSVL---PELRGF--------PVKEMRFRRHMEK-LRNGQQRDLVLCKLERN----- 2352

Human   389 DFRTMNQAHYTSLINDETIAVWRQKLSEHNNANTINGVVQILSSAACWNGSFLEKKIDEHF-KTS 452
                                  |:.|           :||..            |:::..| ..|
  Fly  2353 ----------------------RESL-----------IVQTF------------KELNTQFGNQS 2372

Human   453 PKI-PGIDLNSTRVLFEK-------LMNSQHSMILEQILNSFESCLIPQLSSSPPDVEAMRIYLI 509
            .:| |.|..|..:|.|:.       :..|.::.|.|.:|          .|:..|::|::::.  
  Fly  2373 RRIQPPITFNRVKVTFKDEPGEGSGVARSFYTSIAEALL----------ASAKIPNLESVQVG-- 2425

Human   510 LPEFPLLQDSKYYITLTIPLAMAILRLDT---------------NPSKVLDNWWSQVCPKYFMKL 559
                  ...|||.:..:     :|||..|               :.||:|   |.....:   |.
  Fly  2426 ------TNHSKYVVPFS-----SILRSRTVSGSSRDQSTLQRRGSNSKIL---WRSARER---KA 2473

Human   560 VNLYKGAVLYLLRGRKTFLIPVLFNNYITAALKLL-EKLYKVNLKVKHVEYDTFYIPEISN-LVD 622
            :||  .|..|..........|...|::::..|:.: |:||.   |:..:  :..:.|:|:. |::
  Fly  2474 LNL--DARPYTPPNSSDNATPESLNDHLSVHLQQIGERLYP---KIHSI--NQTHAPKITGMLLE 2531

Human   623 IQEDYLMWFLHQAGMKARPSIIQDTVTLCSYPFIFDAQAKTKMLQTDAELQMQVAVNGANLQNVF 687
            |....|:                                  .::.:|..|:.:|       ....
  Fly  2532 IPTPQLL----------------------------------SVISSDETLRQKV-------NEAI 2555

Human   688 MLLTLEPLLARSPFLVLHVRRNNLVGDALRELSIHSDIDLKKPLKVIFDGEEAVDAGGVTKEFFL 752
            .::|.:                     ...|.|..|....|.|..|:.|   .||...       
  Fly  2556 EIITFK---------------------QKSETSAQSSQPKKSPSVVVVD---PVDDDN------- 2589

Human   753 LLLKELLNPIY------GMFTYYQDSNLLWFSDTCFVEHNWFHLIGITCGLAIYNSTVVDLHFPL 811
                   .|::      |.:|..|.     |:.  |...|.|..||...||.:..:.::.|....
  Fly  2590 -------EPLFYSPGKRGFYTPRQG-----FAS--FERINAFRNIGRLIGLCLLQNELLPLFLQR 2640

Human   812 ALYKKLLNVKPGLEDLKELSPTEGRSLQELL-DYPGEDVEET-----FCLNFTICRESYGVIEQK 870
            .:.|.:|..|....||....|....|.:::: :...::.|||     .|....:.:|.  ....:
  Fly  2641 HVLKYILGRKIKFHDLAFFDPALYESFRQIIQNAQTKEGEETINRMELCFVIDLMKEE--GCGNR 2703

Human   871 KLIPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMV 935
            :|||||.:|.|...|..|:|..|..|....|..:...|...|...|.....:......:||.::.
  Fly  2704 ELIPGGRDVAVTSSNIFEYVRRYTEYRLIKSQEKALEALKDGVFDVLPDNSMINLTAEDLRLLLN 2768

Human   936 GNSNYNWEELEETAIYKGDYSATHPT-----VKLFWETFHEFPLEKKKKFLLFLTGSDRIPI--Y 993
            |..:.|...|.....: .|.|:..|.     .|.||....:..:.:::..:.|.|||..:|.  .
  Fly  2769 GVGDINVSTLISYTTF-NDESSEGPDKLLKFKKWFWSIVEKMNIMERQDLVYFWTGSPALPASEE 2832

Human   994 GMASLQIVIQSTASGEEYLPVAHTCYNLLDLPKYSSKEILSARLTQAL 1041
            |...|..|....|. :.:||.|:||.:.|.:|.||||.||.:::..|:
  Fly  2833 GFQPLPSVTIRPAD-DSHLPTANTCISRLYIPLYSSKSILRSKMLMAI 2879

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511 27/136 (20%)
RCC1 2 52..101
RCC1 3 102..154
RCC1 4 156..207
RCC1 5 208..259 8/35 (23%)
RCC1 6 261..311 13/70 (19%)
RCC1 313..377 CDD:366085 10/71 (14%)
RCC1 7 313..366 8/60 (13%)
HECTc 702..1048 CDD:238033 84/359 (23%)
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769 14/108 (13%)
HECTc 2589..2885 CDD:238033 75/316 (24%)
HECTc 2589..2884 CDD:214523 75/316 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.