DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC3 and Nedd4

DIOPT Version :9

Sequence 1:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens
Sequence 2:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster


Alignment Length:456 Identity:126/456 - (27%)
Similarity:210/456 - (46%) Gaps:55/456 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   606 HVEYDTFYIPEISNLVDIQEDYLMWFLHQAGMKARPSIIQDTVTLCSYPFIFDAQAKTKMLQTDA 670
            |.:...|||...:.....::..|          :.|:|....|     |:..|.:.|.:..::..
  Fly   591 HTDGRVFYIDHNTRTTQWEDPRL----------SNPNIAGQAV-----PYSRDYKQKYEYFKSHI 640

Human   671 ELQMQVAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRNNLVGDALRELSIHSDID-LKKPLKVI 734
            .       ...|:.|.|               .:.:||.:::.|:.|.:|..:..| ||..|.|.
  Fly   641 R-------KPTNVPNKF---------------EIRIRRTSILEDSYRIISSVTKTDLLKTKLWVE 683

Human   735 FDGEEAVDAGGVTKEFFLLLLKELLNPIYGMFTY-YQDSNLLWF---SDTCFVEH-NWFHLIGIT 794
            |:||..:|.||:.:|:|.||.||:.||.||:|.| ..|:..|..   |..|..|| ::|..||..
  Fly   684 FEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRI 748

Human   795 CGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDYPGEDVEETFCLNFTI 859
            .|:|:|:..::|..|....||.:|.....|:|::.:......||..:.:.....:|.||||:   
  Fly   749 AGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKENDPRILELTFCLD--- 810

Human   860 CRESYGVIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLEL 924
             .:.:|...|.:|.|||.|:.|..:|:.|::...:.:.|...|.|..::|..||..:....::::
  Fly   811 -EDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKI 874

Human   925 FQPSELRAMMVGNSNYNWEELEETAIYKGDYSATHPTVKLFWETFHEFPLEKKKKFLLFLTGSDR 989
            |...||..:|.|..|.:.::..|..:|||||...|..::.||.....|..|.:.:.|.|:||:.|
  Fly   875 FDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSR 939

Human   990 IPIYGMASL-------QIVIQSTASGEEYLPVAHTCYNLLDLPKYSSKEILSARLTQALDNYEGF 1047
            :|:.|...|       ...|:...:...: |.||||:|.||||.|.....|..:|.:|::..:||
  Fly   940 VPMNGFKELYGSNGPQMFTIEKWGTPNNF-PRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003

Human  1048 S 1048
            :
  Fly  1004 A 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511
RCC1 2 52..101
RCC1 3 102..154
RCC1 4 156..207
RCC1 5 208..259
RCC1 6 261..311
RCC1 313..377 CDD:366085
RCC1 7 313..366
HECTc 702..1048 CDD:238033 111/358 (31%)
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736 4/21 (19%)
HECTc 650..1003 CDD:238033 111/372 (30%)
HECTc 674..1003 CDD:214523 105/333 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.